SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00818T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00818T0
Domain Number 1 Region: 389-749
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.07e-57
Family YicI catalytic domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 751-842
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000791
Family Putative glucosidase YicI, domain 3 0.0074
Further Details:      
 
Domain Number 3 Region: 134-261
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000534
Family YicI N-terminal domain-like 0.017
Further Details:      
 
Weak hits

Sequence:  PTSG_00818T0
Domain Number - Region: 338-385
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0154
Family YicI N-terminal domain-like 0.025
Further Details:      
 
Domain Number - Region: 35-81
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0248
Family YicI N-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00818T0
Sequence length 996
Comment | PTSG_00818 | Salpingoeca rosetta predicted protein (997 aa)
Sequence
MSRVVPLLVASDSNGKDGRDGAAGAGAGVIRGARGEELRVQFVEDHIVRVTLCPDGKRRV
DRSWIIDPTHDPTTRTTTTTNDDDDDAEKPCSQSVATGFLDEGHPGAEFLRVHGSRRDDL
FSGSSEAVNVVCENQKGSGWSMSSSSVRVSATAKPGEPPALAWHFKDALVARDLPSSPYT
YDRGVGHSGGDGDHQGHGSVTHYMERRSAQEEAYFGLGEAAGRINRYGTRVRLDAIDAMG
YSCDPTNRQVSGPLYKHCPIVFVNVRSPPADADAAAQQPPLGEEDEEYQRSTTSAMLHKL
LDSVEHDDTASPTSPTSVTSPAFSTQEESSDSRQLGASLGWYAMVYDSSARGVMDLGSEI
SAFRGSYRYTQFEDGDLEYYMIFGQDLKSVVQDVSRLIGRPLMPPRWCLGYLGSTMAYTE
APDAQEQLKKFVSLCHSHDILCDGFHLSSGYTCVDGADGGFGPRCVFNWNARRIPDPHAM
FDHFNKAHMRVLPNIKPWLLADSHPEYARAVASGVCVRDPDDPSRPYVGLFWSGGAGTFS
RGSYIDFSSKEGFRWWADRCRTQLIQKGARALWNDNNEYEVDDGMLVCGSGMPMSLMRPI
QGLLMAMSSMSALLAERPAERPVVVSRSGSLGMQRYCTQTWSGDNRTSWKTLQWNTPMGL
SLGLCGWPFNGHDIGAFAGPRPSEELLLRWIQAAIFMPRFSIHSWNSDNTCTEPWSYATS
VDVVRACIQQRYLHHPFMYTLHYDAHVSGLPITRPLVLEFPDDRNCWGLPDAKADRHVRD
CSSCDFMVGSALLVCPIYIPGTTARQVYLPTACGAKTLWYDVASSTWLAGGRTYTAHCPL
SSPLPITYVRDASVICTLASPPSRSTEEISRDGCGGRVFTLYFSQRPGRTCVRHIEDDGI
SNAGTQFVFTLDVCADEEAVTCSLRVTKRFVSYLPVRTPSPSSSSFALPFDEVTIKLPAR
DARALVVNTGEGTHTFAGGSGNVPVVVVAMDDAGTQ
Download sequence
Identical sequences F2TXK2
XP_004998286.1.12839 PTSG_00818T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]