SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00821T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00821T0
Domain Number 1 Region: 51-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.29e-29
Family beta-glycanases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00821T0
Sequence length 454
Comment | PTSG_00821 | Salpingoeca rosetta predicted protein (455 aa)
Sequence
MRMVVMMVVAAVTLASGASATAHNVDVEVNVTAGAAVLPPLFLSVTIDGGFATLNYSDPQ
LQKLTKALSPGYIRFGGNSHQRMNYSFPQQGSGDFATGADATTTLTPEAWNAIYAFAGAT
NMEVVFGLNGLTLFKNMSWNEEPAFPFLNYVADHKQFVGWELGNEPGTSVYPCCCVSDLY
SKRNITVTPGQRGNDFYRLRGILNNLFPITWLMGPDIADSGPKGQAYMATFLKHVPVGML
DGATWHQYYGSGASAKLWMASDPLVLDKFVDEATAYSHVLRTSQHRDIWMWLGETSNFYD
GGSKSVSPTYAAGFMWLDKLGVAARLNTSIVCRQTLVGGVYSLIEHDTLTPHIDYWLSVL
HKRLFGPTVLAVDGGLARARTVRVYAHCTPAAHTFAGKGAVSLMVLNTDNTTAAALRFDN
KKLASSRIGVYDIQPSNARASDTTATLNGNPLQV
Download sequence
Identical sequences PTSG_00821T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]