SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00871T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00871T0
Domain Number 1 Region: 1005-1168,1342-1442
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.55e-65
Family Protein kinases, catalytic subunit 0.00074
Further Details:      
 
Domain Number 2 Region: 598-866
Classification Level Classification E-value
Superfamily Kelch motif 9.94e-37
Family Kelch motif 0.02
Further Details:      
 
Domain Number 3 Region: 89-277
Classification Level Classification E-value
Superfamily Kelch motif 0.00000759
Family Kelch motif 0.019
Further Details:      
 
Weak hits

Sequence:  PTSG_00871T0
Domain Number - Region: 910-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_00871T0
Sequence length 1450
Comment | PTSG_00871 | Salpingoeca rosetta mitogen activated protein kinase kinase kinase 3 (1451 aa)
Sequence
MAVDTPVPLKPATQRRTATATTAMGIAAAVVAVLGIAISVVPCELAHARVIIPYNAPELV
TSKTATPPSLAWHTTTLLALESDFISVTVGGGNANDIANNRATIRLSDDIWVFSRKLNLW
SVCEIYSGAANASDPRFRTRMHHAAERITPLSVYNTSSPARRPLREGAGKLMVLGGAVYI
DNNVTILDDHWMLEVWRSPIETQSFFTCAWTRLEKPAAMAPRFLPAVSAAYHPFELYSFG
GCLEARRRHIDVGDTTEIFLECTDTTNEVWRYTEDLGWSLLAQAVPADSASLLRPLLSSL
MYRVGGRVPRTYMIYGGFPGRASPYVANVSMCTFPDPHAATGSTTFSCQALGSACVFNQY
RECKDEVRFVSRGAVIPLGNNRTVLFGVPDGISDSLVGFLHEYSTDEPAPRFTEIRSLSR
LLTPVFSGASSRIGLLGGFSATPLAAGIDVEQFLFFGDFFRPQTGDAWSTWLYTPQSLTA
HSHAPVLSGVWQDKFFYSSMTARAWPSSQTVGHWVIQLGGYTGSVANSDWKFDVGGVLEA
ERKEREKQQQEEDKAKGESMEDDDDHDHDDDDEEEPVNPEDVVVFDEENVDAEALTVWVR
LDELDQHTSPFSRFYGSSATVNDSAMFVFGGQRKPRSGCANDAFFFFPETHRVVVQEGGP
RPAERRGSTLVRMGSSIYLYGGEDCDNEFFLDDLWRFDLHLMRWFQLSRAATAPIASSYH
TAAALKTSENVTEMAVFGGFRPRNEYDHFGWAFNPQTQAWRPIESDEEPLWRTSHCAVRM
DEGPIAGQLVMIGGASRLGVDLGDGWLYHHASQRWQRLRDNHVRFSLSPGRLGHTCSAFR
DTVFVFGGTSRQRFFRSVIAFRPTCNPGFSADNGQCVPCPLRTYRSDLSNPSCVQCSGDL
TTKTEGATDVSLCNICRDSACVHGTGTAVASDCICRCSFGYSGKACDINVLGIVLGTLFA
LAVIGFATWHVLRFYRRVATSIKQHSALQQRLLDEKEQEIELFEQIWTISPDELQFVRVL
DEGAFGRVELMVWLSAGLNVAVKRLREAILQLDDTCKQDFEREVKFVRQLRHPNIVRFHG
AYLGAQPFLVMEYVERGSLQTILADNAVPISDARKHSFLCDTAAGMHYLHQKGRMHRDLK
SANLLVTMDWRIKVTDFTTAKNVVQDALTRQRRASQVSAGMAHARNATMSALGRQHVEGT
RGGGQGGCSWLDADKKASTMGKVCGGLERTACKFTRGMRRRGQAKSMSVLPRSDGGDKFD
FDELPVSLQAQAQHERRDTGQQLLVADLDDGDGNDETTTDSGGGLEGAMLLTTDSDDEDA
VVIGERPSPAATQRNEADYANIWNQTTGIGTIPWTAPEALADKAYGLPADVYSYGIVISE
ITTRRLPYWDYKGSIRKGVLAGLRPTMPEDCCDRRYIDLAAQCWCENPQERLTFSQIVTT
LQSFDGESSL
Download sequence
Identical sequences F2TXQ5
PTSG_00871T0 XP_004998339.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]