SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00996T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00996T0
Domain Number 1 Region: 1310-1440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.62e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 998-1128
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.83e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 716-861
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000018
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 1126-1256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 914-1037
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000149
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 1438-1562
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 7 Region: 1571-1606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000907
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 857-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000344
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 9 Region: 1256-1305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000607
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_00996T0
Sequence length 1626
Comment | PTSG_00996 | Salpingoeca rosetta Ci-META1 (1627 aa)
Sequence
MADLASSKPRRLRLCCTIISALVLMMLLCNTRPTYANHHHDDDDDDSGSNDGVELCYQVA
WGVGSTYRRHVVRPVSAFPAQHALVTEQYCGGKQEGDPIPHDARWSVYGIPWEAWCSHVS
GGEAFYAYNAPYSDSSNTGFEQPNTDLLYFVVDDAGEVSFVVVHDKAGDGSGGQINIELD
APDLIGTGVDLVLRDDPGRYRDRSTCERSTSTSDCYTFDPNTMTGYFNQIWASCCTDGFV
LGKLPRSNWRFNFKYDVVDHIYNFRVGNFNPDTFDMSFLDLDAAEVLANGVEVSAFTCND
YCRDKCGWCDTSGCLARSEEPTCAGNWLEDACCPSCAAHTDCQACLNADGCGWSFSLGRC
LSGTTVLGLCEASEFYQIPSPGNTICRVLPGPVISPNTPATVPSAYNSPILDWCSGNGDY
VWGVSTTCDCHEGWAGDDCSIQCPRDTNGQVCGGHGTCDQGGFCLCECGWGGPDGDCSQE
IQCDCEVVNNVNTCFINEEDNCPVRCGVVATATDTCTGVDVDFHSQGTDRRVNGSECVCA
EGWWGESCDNACPGIDPVTGEGEVCDGNGVCDVNTGQCTCAPCFAPDKYGNCQPKRCPSC
NGGGRCECDADTGERVCRCPGQRYGTLCELCACENGDCNALTGQCDCDEGWSGELCTFQC
SRESKCHGHGTCDQDTGNCVCDTDYIGSASHQCEFYCPASKCNGHGFCDGDTGECVCQNG
YIGDSCQAACDLDVCQNGGTCTMDETADRGYTCDCPSGFTGYTCDRDIDECRSSDSNGCD
EAHGVCSNTAGSYQCSCESGWQLASNGRDCEDVNECADEADNECDALVGSCANTIGSYTC
SCDAGYELGSDGHTCEDVDECASDEDNLCNTDVGTCTNTVGSYECGCGAGYELGSNGYSC
LDVNECSAAELNECDANAVCTNTAGSYACSCASGYTGDGFTCADRDECAGDSNPCDENAS
CTNTAGSFTCQCRSGWQGDGATCADVDECTTEDASLAHQCDAAHGTCVNTAGSYECTCES
GFELASDGLSCVDVDECAENGGVGPCDGSHGVCSNTIGSYECGCDAGYALGADAHACEDV
NECRSSDSNGCDEAHGVCSNTAGSYQCSCESGWQLASNGRDCEDVNECADEADNECDALV
GSCANTIGSYTCSCDAGYELGSDGHTCEDVDECASDEDNLCNTDVGTCTNTVGSYECGCG
AGYELGSNGYSCLDVNECSAAELNECDANAVCTNTAGSYACSCASGYTGDGFTCADRDEC
AGDSNPCDENASCTNTAGSFTCQCRSGWQGDGATCADVDECTTEDASLAHQCDAAHGTCV
NTAGSYECTCESGFELASDGLSCVDVDECAENGGVGPCDGSHGVCSNTIGSYECGCDAGY
ALGADAHACEDVNECRSSDSNGCDEAHGVCSNTAGSYQCSCESGWQLASNGRDCEDVNEC
ADEADNECDALVGSCANTIGSYTCSCDAGYELGSDGHTCEDVDECASDEDNLCNTDVGTC
TNTVGSYECGCGAGYELGSNGYSCLDVNECSAAELNECDANAVCTNTAGSYACSCASGYT
GDGFTATLPTVTCVNTAGSYECTCESGFELASDGLSCMDVDECAENGGVGPCDGSHGVCS
NTIGSY
Download sequence
Identical sequences PTSG_00996T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]