SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00999T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00999T0
Domain Number 1 Region: 1381-1511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-19
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 1298-1428
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 1033-1161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.46e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 704-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 1114-1244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 812-932
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 902-1025
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 1244-1293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000607
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00999T0
Sequence length 1583
Comment | PTSG_00999 | Salpingoeca rosetta Ci-META1 (1584 aa)
Sequence
MMRTTQQQVFITIAAMMLASTAAPTTASSQPELCYQVAWGVGSTYRRQVIRPVTAFPAEH
ALVQEQYCGGKDAGDPIPHEALWSRRGRHDPSRCQHVSGAEAFYAYNAPYGSSSNTGFEQ
TDTDLLYFVVDDAGEVSFVVVHDLADDGTGGQINIELSTPDLIGEGVTLSVRDDPGTTAD
RTTCEQSTSTSDCYTFDAYTMTGYFNQIWAPCCTDGFVLSKLPLFNWRFNFKYDVVDHIY
NFRVGNFNPDTFDMSFLDLDAAEVLANGVEVSAFTCNDYCRDKSCGECSLDPQCGWCDTS
RCLARSEEPTCAGNWLEDACCPSCAAHTDCQACLNADGCGWSFSLGRCLSGTTDLGLCEA
SEFYQIPSPGNTICRVLPGPVISPNTTATVPSAYNSPILDWCSGNGDYVWGVSTTCDCHE
GWAGDDCSIQCPRDTNGQVCGGHGTCDQGGFCLCECGWGGPDGDCSQEIQCDCEVVNNVN
TCFINEEDNCPVRCGVVATATDTCTGVDVDFHSQGTDRRVNGSECVCAEGWWGESCDNAC
PGIDPVTGEGEVCDGNGVCDVNTGQCTCAPCFAPDKYGNCQPKRCPSCNGGGRCECDADT
GERVCRCPGQRYGTLCELCACENGDCNALTGQCDCDEGWSGELCTFQCSRESKCHGHGTC
DQDTGNCVCDTDYIGSASHQCEFYCPASKCNGHGFCDGDTGECVCQNGYIGDSCQAACDL
DVCQNGGTCTMDETADRGYTCDCPSGFTGYTCDRDIDECRSSDSNGCDEAHGVCSNTAGS
YQCSCESGWQLASNGRDCEDVNECADEADNECDALVGSCANTIGSYTCSCDAGYELGSDG
HTCEDVDECASDEDNLCNTDVGTCTNTVGSYECGCGAGYELGSNGYSCLDVNECSAAELN
ECDANAVCTNTAGSYACSCASGYTGDGFTCADRDECAGDSNPCDENASCTNTAGSFTCQC
RSGWQGDGATCADVDECTTEDASLAHQCDAAHGTCVNTAGSYECTCESGFELASDGLSCV
DVDECAENGGVGPCDGSHGVCSNTIGSYECGCDAGYALGADAHACEDVNECRSSDSNGCD
EAHGVCSNTAGSYQCSCESGWQLASNGRDCEDVNECADEADNECDALVGSCANTIGSYTC
SCDAGYELGSDGHTCEDVDECASDEDNLCNTDVGTCTNTVGSYECGCGAGYELGSNGYSC
LDVNECSAAELNECDANAVCTNTAGSYACSCASGYTGDGFTCADRDECAGDSNPCDENAS
CTNTAGSFTCQCRSGWQGDGATCADVDECTTEDASLAHQCDAAHGTCVNTAGSYECTCES
GFELASDGLSCMDVDECAENGGVGPCDGSHGVCSNTIGSYECGCDAGYALGADAHACEDV
NECRSSDSNGCDEIHGSCVNVPGSYECACEAGWQLSSDSRTCEDANECAANGGVGPCDSE
RGSCANTIGSYTCSCDAGYELGSDGHTCEDVNECLRNTHECSHYCKNTRGSYVCTCPDGF
VLDASGHNCFFFFSTPVGETTTTTTTTTTSTTKPAQRPPPRPRPARTPASLPRPPLVPLT
TTTFQQVATSRCWPGAGAAERKA
Download sequence
Identical sequences PTSG_00999T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]