SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01011T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_01011T0
Domain Number - Region: 585-796
Classification Level Classification E-value
Superfamily Tropomyosin 0.000366
Family Tropomyosin 0.00059
Further Details:      
 
Domain Number - Region: 338-530
Classification Level Classification E-value
Superfamily Tropomyosin 0.00085
Family Tropomyosin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01011T0
Sequence length 1089
Comment | PTSG_01011 | Salpingoeca rosetta predicted protein (1090 aa)
Sequence
MAEADAVRRLDAEKRKSLAQEREIKQLQVDVEQKHTALIEQSQVSRQRLSHLNASLSALR
TQYAGAVTLHQQEQAVQALQDVLETKRRLEDEVAEAKRQREEAQSHVDALRIQQQHLQET
MAALGDTKAMTLQANEWQQRLTRARLQTLQLQRRVHDLEGEVDHLSRAAETSRHRQAQLE
AEAVEMTQSFEQRETAWLKREEQLEKWLSELDHRMRQQTVQVEARRRDDENFLPASEWPI
GQQLSHAIESIKRLLQQRSDLRDETKRLEHRVQDQIVELAEANAATRRAEAAAKTTPHTA
GANQHDADDDDNGDGGGDALEDASLRYQLDRVIKVSQQTIASLQNMLDTREKALDEAHAQ
LDEQHQRHEAEKREWEETKKELEHRLQLQNANTAAPPRRPTAMTARGGDAMQVVDEMRAH
VRRLETDNELLRQDARRAQERLATKEKDLLAIKRELVGSLQELEAEFRGVVEERDALEEQ
LNATKAKLQEAEDGLRAQQREAMSLRQSHEEEAAVMRSALERSQKYIDALSQPGSPKVTM
ETLRKRLARKTAEVKRLQYVLVEVKKPGGDEAALTDALKVPFMEKARALEQERDELKEEL
ATLKSRAAKAEANASTFKTQAEDLQSQLETHRKESSGAVALSAKFERDLKRTKGELEASR
KRCQALEQQLKSVREQARETRAQTVAKAPTSARDDSRKPHVSRDLQEPSSVKWEADKKLQ
KRMENLKSKLATKEEELQAANSQVANLKATIERLKRERNALQRKTKALEAASEDHATLRA
RVERLQEEKTQLRRELEVDANVRVMELQAIVRDLEAKLADKTSTSGKHDDLATDGKKGTL
EKQVLDLKAENLQLQLQLEQAQATDVSALKAELASLREQQQQQQQSGGGAGGGGGKGGRT
AVEASELQRVRKLNRQLRTEREKANERAHEADKTRERLQQELNDCHRNQEMLEAEIQQKQ
QRIDKLQASLERMAANEERLQSRAALPAQAETRLEELEEENRELRAELSAFDPEFFEEIE
TLKYEHQQAKQEVARLRALLSQQQQQQQQQQQLQSSTRQQGVVDVDADDDDIDGDDGDGA
QKDKGEEET
Download sequence
Identical sequences PTSG_01011T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]