SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01065T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_01065T0
Domain Number - Region: 22-66
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000646
Family Hypothetical protein AT3g04780/F7O18 27 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01065T0
Sequence length 77
Comment | PTSG_01065 | Salpingoeca rosetta predicted protein (78 aa)
Sequence
MSCREEHEEHGGHDHHGHHGHDHDHDEPERGVQSSLYDSIDLTKVVGFNEAVEGSAQNVF
RPLHEKQLRDKASEQVV
Download sequence
Identical sequences PTSG_01065T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]