SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01066T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01066T0
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-38
Family Hypothetical protein AT3g04780/F7O18 27 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01066T0
Sequence length 155
Comment | PTSG_01066 | Salpingoeca rosetta conserved hypothetical protein (156 aa)
Sequence
MVCLCSQYVESDADEQLIIHIPFTDDVKIKSICIMGEPGPRHPSHVAAFINRDDIDFDNV
EDLEPVQEWDLVEDADGEQEYETRITKFQGLHSLTLFFSDTFGGDTTKIHYIGLKGERKK
VHRRTIITIAEVAARPEDHKTTIKDHTANTSKTIQ
Download sequence
Identical sequences PTSG_01066T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]