SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01083T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01083T0
Domain Number 1 Region: 4096-4304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000215
Family Pentraxin (pentaxin) 0.08
Further Details:      
 
Weak hits

Sequence:  PTSG_01083T0
Domain Number - Region: 1634-1659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 1518-1544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0678
Family Integrin beta EGF-like domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01083T0
Sequence length 8564
Comment | PTSG_01083 | Salpingoeca rosetta tenascin C (8564 aa)
Sequence
MARFLARTSVLDDSVMRLGTAHPILRIGYFQMGYNALLDTPDSGTRNFTFICDNAFLGNG
ANIGLSGFGELAGPGAAGANSGASYGGPGSGPQRSEVTYGSTMWPRSYGSGANGVARGGG
VISFHVAGELLLNGELVVNGDSASTGAGSGGSILIEADVLKGHGSMTANGGRVTGAGAYG
GSGGRISVQTPDQSQFAGEFRALGGGGSTSAATAGAPGTIYRAQLLFGIPTTSMVFRNGG
VRPQLPTSFNVGSTASTAVDVFDLIEAAEVSFECSTTAKIILRRVTGDATARAYVRDGVS
LYVAASRAASSRPLSLPSAFVVEPSAELVLPQRVTVPDTSVSPTLDLQGLLTGGNQMVVS
NGATVRFRRTSHTATGEGAGSYTFIDPPGQLSFRYFEVAQDGQVTIEGDAEDGAYDGVQG
SDVPSQRHTRVADTAMHFSAVDFLLTAGGQMDAGHVIFTSTTFTVGYGAVLSATGLGHAF
GQGFGGGLMLGTGGSYGGASGPVSGTHVNEHGCVYWADRFGSGGGNTNGGRGGGFIRVET
QDASIDGRVAVDGAHAGGSSGSGSGGSFYMRVSDTMHGVGTISVAGGDATCSTCGSAGSG
GRIVIEVAKTNHFQGSLLTRGGSGRLGHGASGTAYVTSQPTGYPFRQLFLENAKRDTDPN
RGPQYALFKYNPELKKIAPVSPHRHVRIDQENNVVPQPALIMDTTGDFIDFDEMTVDGYA
KLYFYHPDDQEHVTIVGHEVRGDRTGIIRVRSNQRFFVEVVVAAENVHDAPVTYYVDEDA
ELLMPPNLILRGEDLILEGRLTNVEHLYVESGGEFVCDGQCHTALLTLEKSNDTVVIHGI
EYEVVETSKSFYPEDAYRSLQDPHSMKFSTVEVKNTATLNIKVPNADVEVADFDIRFGGL
VRSNTQVLTLNIGESFFEHTGRLVADGSGYGANTGPGASSDTGDRGCGGAYANVGGRGDY
CSSLGSVYGSVFMNSGRMPGSGGGGSNAGAGGGLINLLVGGRLQVDGMISSSGGNGGSYS
GGGSGGGIYVNTERLTGHGVIQANGGNGGAYSGGGSGGRVVVHITAHEFRWDGAVTAFGG
RCGGASTDNGGCHTDTEHGGVGSVYVRSHPDDGAAFHTLILDNRGRNRNTYPFVLDEGQV
TFDHLHMVNNARLQFSTKTTPSAPAFFKSVTGDLTGLLYVQSGREVHIGGRELEASYPAV
DMTVDTDGQLEGTLRFFVRDTFNVHGMLSGVQSLYLLPGTRMNINGGRTTCLEGTCSAAE
RSWMDNNYMFKDLVLYKGASIVDSNSNGNTKSLERVKDITVLHADRLHMQYSSSVTASTI
AIWTRQAKVDQRASLSTNARGYTAKTGPTTPTAPTYGEYCASSVAGSYGGRGGRGKHGNS
YCGVEAGDPYGHACYPYHAGYSEGGGAVQIIASTRLEYDGSASSNGGSGHSGSGGGAGGS
VWLEADYLEGHGTTQARGGNGGYHSCYLCTPTYGGGGGGGRVFTSAFHEANIDIQQGYSV
AGSPTYDDGDDGSQCVNTACSGHGSLVAGQCQCNAGWAGLTCSFQDFCEASNGALNAAGE
CVCNAGWSGYRCEYQCDRDSTCNGHGECSPLGQCVCDPCYGGQFCEQECSGQGQCIADLC
RCNACFHGQFCEIECSEHGTCSSGVCDCDSVWYGELCELPGCPGPDRNCNGNGACNAYLH
QCVCAVGWAGIDCSIPDCPGEPDCLGRGTCSPDFADTPRCIDCDEGWMGIGCNEPCLHGT
ETPKNSGTCVCEPGWAGEGCNRECSGHGKINATTGECVCDFLTGWRGPLCDIPGCPGYGV
DCTGNGECNNADHTCTCYPGWRGVGCHIPDCPGEPDCHDRGTCDSTNYDIVRCVDCVGPW
MGYGCDEPCVAGTETPPNSGICVCDPGWAGVGCDAECSDNGKYNTDLKLCICTYEKGFWG
DLCDVPGCPGNGPCLPGSEAEGVCGLSDAERMRVGKSCSGNGECNTADAVCECNPGWRGP
GCETPDCPGEPDCFGRGYCNFTLPNPVCQNCEQGWMGPDCNTPCVHGVQDPPNSGICVCD
PGWTGESCNLECNGHGTIDSATKTCVCHYLSGYWGERCDIRGCPGNGPCIGGETADGVCG
LSGVERMRIGQSCSGNGECNAAEARCDCEPGWTGPGCETPDCPGSPNCFGRGFCNYTLPT
PLCQDCRGPWMGPACNDPCVHGVQDPPNSGICVCEPGWAGRGCDAECSNHGRIVNGKCQC
TFELGYKGSLCEVPGCPGLYGLDCSGHGECNAATTECVCSPGWAGIGCHIPDCPGTPDCN
GRGFCNATAPGQPTCQSCEDGWMGPACEQPCVHGHQEPMDSGYCKCDPGWSGRGCDAMCS
GHGVIVDGKCDCYTTEVGNSWRGELCDRPGCPGENGNCNGHGECNGATGECVCDGAWRGI
ACEEPVCPGNPPCNNQGTCDPLTQQCQCNSNFTGPDCSLPCVHGAFANQTAGCVCEDCYT
GISCDTVCGDHGDCVNGVCQCDFDLGYSGPGCEIPGCPGSSSTVQVINGTRTVLQRGVPL
DCSGHGECNEALFECTCEPGWKGIGCDTPDCPEDCNDRGTCRPVVLEDGTVDVRCTGCAV
GWMGEACDEPCIHGRQEPMDSGICVCEPCYHGDGCELLCNDYGTCPSTQQCLCHAGWLGE
GCDQPDCIGDPDCYGRGTCEGLPREQPRCINCDDGWMGIDCNEPCINGTETPKNSGVCVC
DECFSGAGCDIMCSGHGTCNNGMCECERRADGLWLGWYGDDCSVRGCPGMNGESCSGHGD
CNEVTQVCTCDDGFRGEGCEELDCPDDCNDRGDCVFDEVLGEPVCRNCTQGWMGPACEIP
CVHGHQEPMDSGNCKCDDCFSGFSCDLECSNHGTCAEDDDGNAFCDCGVPGVGWWGPLCE
VRACPGVGSPCTDHGLCNVATQECACDAGWIGTGCHIPDCPGEPDCFGRGDCTGLQDPPV
CTGCHHGWMGPACDIPCVNGTQIPMDSGICVCEPAVCFDGPNCDRECSDHGVCVNGACEC
DEAWWGPKCNIKGCPGTGESCTGHGVCNSEEQLCFCNPGWRGPGCDIPDCPGTPDCNGRG
TCYAGVDPPICLNCTKGWMGPACELPCEHGNQVPMNSGNCECDPCYTGVACDIECGGLGT
CGCKPGFTGTYCNDFDCPNGCSGHGECVWPDGDALPSCDCDTGFGGEDCAQYVCPGEPMC
SGQGECVLYFDSVVPECECFNEKILGSRCNQCIQDWAGPNCTVWDGPLPLGCNLTQLATA
TYQISGKQFLEVHGVNVTLDEASRTYVDTADQPVNTTLLCTPVPGMDSANTTSSGSNNGT
STLMDGSSGNNNSNSTAPNRRRRAVIGRGHASQEAVAERSRRSFVSPDPALGISLDNLQC
HCKPGRKGEYCEFIDCPGEPDCNSRGLCLVKGNNTFCLCNDGFEGDACERLVCPGIPACY
GRGQCVVPPGKDVPECVCDNSFDGDACERCADRYTGLGCERCEDNYIGWSTRGCSVYCVN
GRGVGEDEDICQCYDDDDNGHWTGASCTYCQEGWEYPACTRCHEDYGAEGCGLRCKAGHG
DVVDRSEVVAEDTGSGSQDDSASGDVSLLASDARPLVPKLECVSQTDNGVYEVWLGYENF
NSVPLNVPIGPDNKFIVTPAATDLPPFFAEEGTSTAASTATRTNENLGQPTRFRSGRVHY
VFKIVLATATDSLTWVLTNTKANFHDKYLILRVADAPACTGTIPGDGDGDGDGGSDTGGS
TTTQPDTVAPTPANGLDEPVCRCRHGYWGDTCDFECPGGGSNPCNGHGTCSATTGECQCE
LRWSGIDYQEYRPRRDLDSDEDNESSSADSDALSTQAARRRVRREFDYTYPNHHVPEQHP
STKAPYRTSCSRCADGWIGYDCSVASTELTPGREPYLAVDGFGHFVSMDGAAFNYYASGE
LLVFDSEQPELKLHVRQTTCRGGKAFCVTAVAVTVGSTVFVLRAPYEDGQAVLMWSGGRP
VEVGLGGQVVDFTIAEDYVLRRSGAHAYTIVSEDKQIRIVVRVFGRALSARMYAPVGICN
FAGGMLGHCDDTPTNDFVFNADGEFLADVGQGTIVSTNLTQTNIHELVGPFWAVTRANSP
FGVVYGYAGYNERREDSVAGFALHFNDTGCSSKPLYTFSDAAITLEFLVFAEAHGGTLLS
FATSHTFAVVNRLVCLDSVTPCPPEFVSGQLVIIWNGRLEPDFAGVAPVLNGLNNLLELH
YFVSHPTIGSDGLPQPKSFTFVLAGNPFRPGGTLTLGQFGLSTIGGDSAPASVFVGSIDE
LRIWNKRLTAREISRTWGTSVQPDASGLASLWKFNEGQGESVRDSASSIDCASAEFDAPC
LYLPPRSVYRAPTWRFSDANIAIDSMSTGIDALYKTSWTSVTLRIEAQRRCQAAFNATSA
FGVTCRQLGPAIRQYFEDSCTADISRGEALALGIVPIVGFADMCQASLDVVTTWPGASYC
QSFPQGVIRFPDFFGAACSQTCFFGTFDAASSSPSCACLSGYWGDSCAGVCPGGAVHPCS
DHGTCRVTSGTCLCEPDWQGDDQCSSCTAGKSGADCSVSDVDLPVVQLPLWSIFGEGYFT
NLIGRSFTFDLQGTFLMSASPTEAFEVYARQVKCLYSSASCTNQVRIVIEDDVTVVLDAD
FETAAVALRVGGSLLDLSGSLQLGYGYKLVRESQRSYVVTGPDFLKVTVTLSGKFFNVDG
RVSRDYCSASLGIMGTCTDGGIVRRKLQPYDGAYETCRVSGASHWRTIGDAVFSEPRSCD
YVMLRTQNQTMSVTANDTASSDAFAVYVKHVACGATQCVGGLAIEVPGIPTIVLASDTSV
RVGRSAVSSFPAELINNHEIVREGATVLAKLHASKVLVAWDGYEAVVKVAEDVYAGAVEG
VCGGFPGVDPFTKSDGTVAGTQAGFFSSWQTADASDALGTNPACTEPTRPTPPDAGEACA
SIPGADETLAQEACSQLLPGSGFFESCRSSSGSSSTLDFGALFDACIDEVCQTAEETSES
TYKQAGCTFVQTVSELCIAEGHTRDAAVVDRCGVCDGDGSTCAADATCTVRDGMLIETFD
EHVWQFPGMCTYVVAKDCESDAFEVQATLAACGDGSQRCVVGVAVQVFDYDTVSFYVNDG
VWEAFVGTEPFEGIRFALGGSSVVSRLSSGFEVAVPDLTLTVTWSVVTGKIAVQGSAAFL
GKRMCGLCGNFNGVASDDTIVGLMEDNSPYLYGSQQVVGFTSHLLKFANRTCSDEEEPPA
ACNSDACLALRDRYGAFAACQAVVDPQPYIDACESAPCENAHASICATRDAYANACLEAG
APITLEPSATDVCTPCSSELPCAGEVTCDYAFRGIFKSFYQDVSVPMYPSCTYHLLSMCG
GDSSGTVPLGIVANFSSADNSVESITISAGEDKLSLFVSSASDVPVATFNSEPQRLAAGH
VFGSHMHIAGISDEGVVTAAIPDAGVRIVFSSTNVQIIAPEQGIGHQDQACGLCALPNTQ
APAPEDVQKHAVTDAVCPTSVTVTEQQPCAAATAETLAAAMEFCSALSSNASKLAFEATC
PTLAARMDDLVRTCIESFCSASEAAACDAIARAEKECGLRLPTATRDVCGVCGGDSSSCI
LPYVSAFRGSFCSLDGRLGLLTEFDATTTVFEKKCAYEVLTLSSSSSSASSATVGIEDSR
AHVLSIQTQNGGADLAIAVSVPADNGANDINTSRSNATTTITVEVRDGGSTVLVDGSDVT
LPAMLGSSDIGLVSSTGAVTLFGGLVKVSLTSSQTGWSIAVHASLLPGAGAGADITSAMT
DVRVSGGVCAGGSVGSLQRLGDDVLFVSPTCNAPEPEDAVCDSAGASERVQSMCSIVLGS
DYAPCREAINLTAVYEGCVRALCSLPSSTADAEMTNERCSRLAALEQHCFANNVQGIVSS
FDVCGVCDGDGSTCNLANGCMALDTSVITFSPDPRYTTSSSVLMTLGDVSNETTCSVLLL
ETEHLQVMRNVHTGAVTITVNDTTAVASGSQQEGVVQSLLIDPRQSGRVLLGKDRILTGF
PYYLPSLLLTHDGSEMTVHMYNGTAVASGTTTPQPLLVQVRVTDGADSRTHVQVGSNIIT
AASISGETRSACLASVSETPSNVLAAASASTCNVQPNDNGTVVDPPTATDDGLCDLAKTL
CADLNDEQPTAQYEQCRSVEPTKTSAAIARQEACHLLGMYERACATRTGGLLEIDSVRDV
CGICYGDGTSCAQTSEQCSLSGVNSVVTLDDAALGTVPTECEVLLLADKVDAQSLLVTLS
RQTTDTFAVGVSRHNSWQLTIASSGSLQVQHSGDAGTVAYDAGAGVSLLFPSDDTRVSQL
SSSATVTVAIPAYGIAITVSPVSVKLAIQADRVPAMFGWCTSFSRVPNGVASVINDAKTL
AISAETAMFAPKVCVPPPKDTTTAASGPCADASGDVQAQATEYCNVLARANSELSPCFSV
HDPSAYLEACLASYCSASTQKLAMQGSCTAISDYQRTCKRSLVVIEDVVDICGVCFGNGS
ACADEWTKCTLRGASAVRPFETNSTFTFAGTSAYTVLEDCRLSSLSVTLERCSYTQSGTS
VVVELDRPQNATTEVIRLLPSVVHVTAEQDGMRSDFTLATLLGIRRRKFWPVFGAGGILL
NGVRQRARTRVSTGDELQFVFGLATVDGGYVFEFPFTTNSGTVLETAAAGLTVRTPQLVL
AFDGEDVVTTQVRKRLLARGCGLCMGAAHLSDSVAAAWAFGIQWAKPEQCGTGANGTVVV
DPNTPPRNPCEQSEELLQVAQDYCHVLRDTAGPYATCLAAGVGRTSRLFEQCVYDFCITL
AAEAESATDTTSISTDTSAIIDLSLTLLIGTPAAKAACTDIVALEDLCIESGFTAIETVL
DECGVCFGDGSTCASSNLQCAVLGSHVATVSNDLQTFHGQCSYVLAEDCAHGSFAIHGYK
PEGSDAFTRLLVRIGEQALELDGPRVFLDGIEVTEVPSVLDGGIVVRSDGFDLIVTAQRE
GLVVSWNPFSGQTAISAHVRLSSVLCGLCNTALDDVSTYGSNVPGCAVNGTCTFEQAGLT
WHSPETDALFLGPSGAMCSPRVLERDSPCLNNATLQALAEDYCAALASDVGPYAACHAWA
SPSAYVDACISDYCTGGAEKACGVYAAYEDRCLKSSPDPVEASSVIDRCGLCFGNGESCL
ETYSVSTVFGDPHYVTLDKTVFSFSGTCDYVFAKDCLYNEFEIHVRNRNVTNAGISTFGV
GITSHGSPVVELQFTGDVLVDGQLQTKLPLLLRGGTTVSRTLQGTLVVTMGNGVEIEYTE
DAILSVWVPDRFSDRVCGLVGKYDNVTSNDLVTSAGVLTTNAYKFGLSWAVVNVTSAPST
LFASREGVCYHEPVPPTPVDPCADADAQVIEEGRRRCTIIVDTDGPFASCHRVLSPEPFY
EACLADMCYPLHATSAIRQYDMLCKDRGWAPQPPIIDRCGVAFGDGSSCAQELATCSAFG
GVHFTTFDLSAYDFAGTCSYVLAKDCEESSFEVQIIPHPTAGTFAVGVRTLGQHHIEVHS
GTLMVNGRVTSTALLPMLLARDSTQISHELDGTLSIELHSGIEIRISNALSRITVSATSS
FKGRMCGLCGDFTGSAIDDFKTADGYVYTSINTARTYVFANSWQVPEGTALIDSHNSECI
GPVQPPPNPCNLDSSALTEAKRLCVLSPGAVADSATCSDSLVSSLYDACLRDACQALTSG
RAYSQCEGAASFLEYCDANNEYVRFLAWDRCGVCGGDGTSCAEQFPTCTVLSSGQVLSVP
GAIVKPLAECDFVLAKDPHGVFEVHARFVCVPLHGTGLGATSNIHVAVSPLFNNATGGLC
ALYNGIAADDSATVDYDRVSRASSLLWYDAPNTWETYNKRPDGYQPSDECQSAELEAQAV
TVCAAAGDMAQECIKDVCATGDLDAAWLMIEAWRSRQEAEDRLRDRTDGNGTTTTTTTTA
APYTTTLPLEPEPPVIDPRPPVQPPVDSSRGGLCTSAGDPHFTTFDGARFDFYGVGEFYL
LRSPLVEVQVRHEPLGSASGNTAFEALFRESGLRVGMYPSTGRLIVRTYNSLAAELSSSN
PTFQASLDGVNVRCEYSRSCTLYSEALGFELTAQGSRYLNIHVAVSPLFNNATGGLCALY
NGIAADDSATVDYDRVSRASSLLWYDAPNTWETYNKRPDGYQPSDECQSAELEAQAVTVC
AAAGDMAQECIKDVCATGDLDAAWLMIEAWRSRQEAEDRLRDRTDGNGTTTTTATPFIDS
SVSPPPAPHQCYALADRLGDFSFCHEHVDPRPYVVACEEALVVVDTEVSSTLTFVSGSTS
TVATPIPPSTCEVVQAYRDQCVRSGVTSIPAIVDECGVCFGDGSTCSGSFMTCFMRDVGL
VRTFSGYENAFSGICDYVVAKDCSAMSEFEVQARKTACGLSSCNSVVAVRFGFNLVVEIA
GSFVTINGQETSALPLTTVEGVVVQKGAGVFTVRLPNSVTVTWAPASGQLQVRAPAVTFA
NRVCGLCGQPLSADATNNDDPASGLITSNGVVAASLWQHAKSWLVDTEAASLFVDPDPFC
TIDDVPPADPCSFNATLADWADRVCSKTLRGREYSACHAVVDVA
Download sequence
Identical sequences PTSG_01083T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]