SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01084T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01084T0
Domain Number 1 Region: 264-408
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.81e-24
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.002
Further Details:      
 
Domain Number 2 Region: 8918-8963
Classification Level Classification E-value
Superfamily Kringle-like 0.00000177
Family Fibronectin type II module 0.012
Further Details:      
 
Domain Number 3 Region: 835-898
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000833
Family Plastocyanin/azurin-like 0.019
Further Details:      
 
Domain Number 4 Region: 5602-5797
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000714
Family Quinohemoprotein amine dehydrogenase B chain 0.06
Further Details:      
 
Weak hits

Sequence:  PTSG_01084T0
Domain Number - Region: 6942-7054
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00984
Family Galactose-binding domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01084T0
Sequence length 10836
Comment | PTSG_01084 | Salpingoeca rosetta predicted protein (10837 aa)
Sequence
MVAVLLVVLSSCSATSAASTCTLQTVNGQLDRIATSCDISADHTFPRSVTIADDVVVTMR
PNGCTYPRATVNGDLTLSEYATIEAEPLPRFCTTAATSASQGQAAPGGSFWSSGGHSSTL
QAPIAPQDTIQLKGGVAGGEDANGLGAGLGGGVVDLQVMGTFTLDGHVRANGQQASTDGA
GSGSGGSIRLACDTLQGSSTSASVQANGGIASAKGGAGAGGEVYVDAASVSFNTAFIQTF
GGLGAPDELFNEEHNIGTYTASTQRKASNYYDKYNRLQSYYYAASRAFLDATYEVIDSFR
YAGGWTPNSGDSNPYVQVNLQGTYLVSGVVTQGNTQNNYVTRQFQVKYSTDCSQFTTYAE
DGVDITFRGDSDPDTRVVNRFKPVFARCVRVYPLGGYNVGLRMDVLGYPTEVSSSAKHLP
VRPTALFRNGCPENQLHHGSPSATIAFEAPVATDSSGAVAQTADAVWPQTKVQAQTSSPA
TFSSGTHTVTFNAKDGSLDVDTCTMTVMVVATQLTQGLASCPSDMTVEADVDRLDAVVDF
SVPVGVQSSIAPNSKFHIGSNVVYFVDAVSATYCSFTITVTEPTQRSRSGGAGIIHLKQQ
QVLAVDAGHRFRPTDFTPSTDYTAWLSSYEDTAFLYNPTLWNGEVSTLNIRSGAVVVFQG
AAASVAFDDITGSSGFFHVMETQHVTVSGNIHARSAVATGATLTLSSSQSADVVGVLAID
GALETPQSPALSFTGAGTAVTLAASSPTTGISTKGLTLTDASFVVRRGNPASAWSVSCTG
AGDLQLSSSSFLLDGPVLLSASAVSATSSKLLFEAQDTATVTHSAVLSTGAGWQQLNIHP
GDTVQWVWQNEQHSIAAADGSFSAGLTRSNVLRHTFDTPGTFNYTDAAFPSVVFSVVVSV
PSWAAASGSVDVASITATSSSTLRFGAISTLVSPAVELTASTLHADVSGGTSIDTFQATS
SSQALFYRRVQWTGPASALASLLSVASSSVVYFDYRGYVAGSYTSTSDIAVNTWTVASGC
SMFPGIIHFTMPSMQALTISGAMDLQLATPGDTLPAQAVTVSGTCNINYPVSFSGLTSLD
VSGTLILDKVGHTTGTWNTQASSGIGATVEDATVSVSGTFNAGQIAIRAASVTVAAGAVL
TMRAHQQQLHVDTLTVNGQLTVENRVSMRAQTGTGPLTQLMVSSGATLSLDDDDEGNADG
SSVHAAAVTVTGTLTARLLALVTDSLSVAAGATLSMTAKDNQLLASQLSVLGNLFVSNQA
AMRASDGTSDMSSVTVGANAMFILDKAVYDAGSTTWSSSTGSLLAVSGALAVSGDFKAGL
IDISTDLLTVSAGATLHMEAKGSQVRTGSLVVNGAMYVLNQAAFTAKDGSSDLTSVTVGD
SAKLTLDKAVYDASSTSWSSTTGSSLPVSGELTVRGEFNAGLIAISAGPVTVHAGATLHM
EAKNMQMRANSLAVDGAMYVLNQAAFTAKDGSSDLTSVTVSAGAKLTLDKAVYDASSTSW
SSTTGSSLPVSGDLKVVGVFNAGLISVSAGALKVNSNGQLHMEAKDNRVLVNSLSVAGTI
TILNQAAFNAKDGSSDLSSVSVSGTLTLDAAVYAASSTSWSSTAGSSLPISGALSVTGTF
NAGLMALEAGSVSVDPTATMHMEAKDIRLLTDSLSVAGTLTVLNQVQLNAKDGSSDLTDV
TIAGTGKLLFDEATRAASGNWTGTPGSLMPTAKLTVYGIFDAGLLGLSTAELFIGGGGAS
LTMEAKGAAIAATKITVNGKLLVDNQADIRAYDGRSYLTTVTVGNNGLFVLDKVSHDNTV
AGAQAGSSLYIGALSVSGTFNAGRLEFVGTSISVSGTMTVLAKAARVEVDQITVSGTLTI
DNQVDLRAKDSLSPLTAVTVAAGGVLTLDDSGHTSGTWSSPTGSFLDVNTLSVSGTLRAG
LVALAGNELTVEQSGAMTMEAVSNEAHITTVTVRGSLDARTQVRLHARDGTSRMASFLVT
PSGDVTFDVLGHGTAGHVWSGAATSLVHAATITVQGSFAAGRLETVGSGTDTLTVTGSMT
FDPPQPGAITKFASMDVSGSLKARRPVNLTTTDTLTVSGTLVLDDDSHTAGTAPAWQANP
PSALGALVNDLAITVSGTFKAGYVVLRADSLSITSSGLVTMDAAYAHDAFVNSVVVRGHL
NVLRQARFRNVDRVTRMTSFKVFSGGQAILDVLGYNTPNHDWSGTASSLLHAESIEIGGV
LQAGRLETIMPGASTLVVSGSMDFDPPQPGAVALFASVTVSGTLTVRRSVDLQTLTSLDV
TGTLKLDADGHNNPGTWDQYDESVIGRSVEGISITIANGATVNAGYLSLRAAKLTVRGTL
TFDAHDFKAYVDEMDVYGTVTVRRQVRIRNQDRSTRATYLSVHYGGTMTLDDLGHATQDH
AWTGVSSSLLHFDAITVHGTLNAGRLETLLPGTDTLTVGKTQTSVNPLRYAAGLFTFDPP
YPGADALFAVINVDGTVRVRRPACFNTTAQLSVSGDMTIDLDGHALSPGAWDAYTPSRIG
HVLDNVQIIVSGTLKAGYMRFRSQLFKVDGGYVTFDAANKYWRADVVNIDGRVEVLRTVN
LRSQHDMGRVQSITIHPNSFLIFDDLGHDTPSHDWSDAEGSSYCVETLTVAGTFSAGQVS
IVYETVPAATISGTYTLDPAFPGQKHMYSNLMVSGLMKARRPINLNATEFLEVTGTLTLD
EDGHAASPRAWYAYEPSRIGTTVDNVYIRIKDGTFNAGLFELRANLVELLPLPWTSGSSS
GVHRRSKLTFDAFEHLARVDQWNITGTVEAWRHVNMRSQNAGVMIGLTVDVGSTLNLDQV
TRQAGATFTGESSMAINDFYVKGTYRAGKMAVANPVQPWWTHMYVSGYFEFLPSRLYDIN
TCRIANNGRVHALEPLGRASEWTADWIVVESGGEMDLAFDNPSITSDGASGTGHSYVNST
LLNVAGVLKAGSLSLWLGEFVVSGMVTVDGQGHFATYGPAAGIAASGAGTGGSNAGRGGR
TPYTTAAAPVGTIYYRYAASTPPVENQMPSVWGSGGGLSGSGARGGGYIQAHVYGPSGTH
ITGTVRANADSAGGSGGGGAGGNIYLLTTSLTGSGRMQVIGGNGAGNGGGGSGGFIIAHY
ASGKWYSDQTDVQGGTGWENGGSGLAYLVGPNNFRNLRADNRGRSSRMQTDADHASVRQA
GAAAFLLPETETFNFEFEYVEVYGAAHLVFQHPTDDNSHARITATEVVGDRTGYLHILPN
QTLDITSVEPWKRYNISFMPQVYEHADLILPQRTVEWRCQNSPAYPSLSIPCTIRTWGFT
NMHRAHLLVSHGATWQWQLTSVRDLTCVGMTVQDTGTVDFLSAVADEADVYTLTVVEDAQ
NEGERYGRLHVEGGGQVLAHNLIVNAVQVQVDDEGSISANGRGFNAADNGPGTPTCSNCG
AAHGGRGGLSGATGATSTAPVYGNLTHPRSFGSSGSSSRGGGLLEFVVSDRLWLEGTISS
NAGGSLASGGSVIVDVNYFEGFGHIQVHGGSGGAYGAGAGGRIAVHYKRIHLFQGKFEAY
GGTSDAATRNGGAGTVYLNDASFGVVNRTLIVDAGNRDQGGLDMVPDFDDISSDSGRTWL
PALTAAKYDFEIVRILNKGELAMMPEMKQPYGLHVDRFEGDRTGVLHTGEQQLMVGQFSE
LGEVRVNQYAYRYGHLELPKKFECFGITIRLLGFLGGVEDLTVGRGCVLELSKFGATEGQ
NPSVYSFNSLTVLSGGEVRQYDNDPDAWITLQANVLDVRGGGHVHAPRLYVDAGNVTVRD
GGVLSADTYTGTECDAIHEGSSGAGAGHGGTGGASTVTTRVGSPRGHLFEPEHTGCVGGG
SGAGLGGGILKFNVTGRLRVDGVVHANAADGSGGGGGGSGGSIWLQVYHITGYGLVQTLG
GKGGASGGGGGSGGRIALYFTRNETFIGSFQAFGGEAQHTNAQSGGAGTVFAYHDHHKHR
TLIIDNNHIARQPAPKSRIPSFTDITTDGGRSWITPSARDHSLAEDNGYLFEELQVMGGA
HFAVLTDPPEQLLSVYFENMIGDRSGTFHVGPNQELDLERLYVDLPFHTRVYPSGFLGLA
NVTDVHGVSFFLEGVIGRVKNLTLHHGGEMHMYDGSRTNHTGRNHYDFDYVLVEDSGLVL
MDTDPVTEADMTISSIATEVEGGGTIHGTHITFIAANLTIQDGGVVTASHRGYRTSDGSG
TNGVNGPVNPGIGIGSNFGASGAGHGGTGGRGNGATIWMNITEHVLIDGEVSADGEDAPY
ARSGGGSGGSIWLHCHTLSGFGNITARGGNGGLDLDYAGGGGSGGRIALYFVNNRTASDF
DFHVYGGIGYEPGAAGTAFIWHLVYEHKTLLVDNNGQSPLGRRNHLHRTVSAVKYEDTNG
RVWDYTEDDLRQAGGRTMLLANHGDHEFALGNNSFHFDELQMYGAGHLVVFTPGENASLY
FTAMIGDRTGVVHLHGTQEMDLERKEIDLPFSLWAYEDSRTVLAPATEVFGVFIQMAGNL
VGVDNMTIHHNGRFHCNHGGHTDGEPASNFHFYNLFVEDKGLFEMETHPVRDPGINVTGY
EFIKVEGGGRMHGTFVHVFAPRMQIDQGGALAADGMGYHVRDGVNVVGLHGIVNEGRGKD
SSTGASGAGHGGTGGKGFGQSKTGFAIGDVYEPYVLGSAGGTGKTIDDEHGSRGGGLIWV
NVTEDLLLDGVISANGVEGQKDSSGGGAGGSVWVHADYIHGYGAIYARGGDGHRHAEHPG
GGGAGGRVALYFYRNRTSTGFHFSTCGGRSAHEVGGPGTAFAWSHVHEHRTLIIDNCGGE
PIWRKNYLHRYVNAIELTAADGKEYTYNDLSEDGGRAWILPVSGTHRFAGYNYRFHFEEL
QVHGNGHLAFLSDPPYTRDVDIYTRFMIGDRTGTVHVGGNQTMDLERLEIDVPFNIWAYN
NSHVGLGHFTDVHGVFIQMSGRLSHVRNMTIHRFGDFWANEGGRTTGQARSHFKFDYLRV
ADQGQFHMETDPVDDLGITIETIGTYIEGGAEMRGSKVTFLGQDLIIDDGGHMNADGLGH
HVRHGTGYSLHGVINAGAGIASANGASGAGHGGSAGSGYGQSRVGQPYGDFYEPGLFGSA
GGSGEMDDTAHGGRGGGVLWFNVTNMIQLDGVISASGADAEVKFSGGGSGGSIWLHCNTF
KGTGNITSHGGAGYFHVDDAYLHPIIPNKSGGGGAGGRVAVYFVNNATYTGRMFAAGGAG
LLEAGGPGTVFVYHMVYTHRTLIIDNDGQSPLKRRIENYEDLSEDGGRAWILSESGTHRF
AGGQHMFHFEELQIRGYAHLAVVTEPVYTDVELFYRHMIGDRTGVIHLGRNQSMDLQRSY
IDAPFSTYVYEGGYYGLAHDTDMDGVFVVCEGRIDHIQNLTLIHGAALYMNLTGASQGLP
DMSFTFNGTVRVKDDSKISALQPLAHPEPFKVTAAGLVVEGGGLVDTTFMQFYLDYFTID
DGGVVNASGRGYSAMQGPGHGFANLRGHSGAGYGGRGGRGAGRDGNDLWLLPNGEPYGDI
YNATLYGSGGGGEQGGAGGGRLEFHVSGISHIDGDILADSYNVIDFTRVVVEHEDVVLWD
HPVKTMETYSYGGGYMPALREYWYPSWSGTTVFRYDDEYTRIGSFNAGADDIMQVTGDRD
DFYYLARWSRRVVEKRGPFPNTDRQWSANLGCTVGGVAVDFDYVYAMCYYGNKVYRLSRD
TGAILGSPIELKGGRHDFDSAPLYGGLHVVENKIYDVRSSGLYRYELDTGEFDHIFKELD
ISGVRSTAFNGRDICVSSGNDNVYCYTVLSDNIWQRLGVRDGAGGGSGGSILFRTGAFVG
GHTGDISVQGGAGDLPRGGGGGSGGRITIYHNSSEALHTFYYGKYDVHGGYGADLAEPGA
SGTVYIEHTTTGENTLRLDNTDEAGDPQYALTDAIPNRGSRIDLDGGATSSNTVYEAQGV
VVTSSHATYSNRYIANLFTHTYSLEYHDYFAVDRGTSTLTMDLRATKFVSYIRVFPHCQY
RTDFKVETHLTGESQNVDVTSNYVEMRHTCVTGAYVELPVLREVSEIVFRLRRRDALIAL
SAIEVYTDARGPGDRYKHLSLDSAKTWLMSADTTKFHNFTKLELFGGAQLALHPDPQSRQ
QHITFDNAYGDRTGWLHVGPNQDIDVVYASADIPFNTRVYEGGMMTFPRRAFFTGVQLHV
SGEVYGLTEAYVHTDGFVRVDTNGSIATGTPGSALLEDLTIMADGTLELFAHEVGHEGFM
LNATNFTVFGEGHLISNTRLRFFSDDVEIGSGGNINLNDGGYQSREPYGDLYRPLEYGSN
GGKGDDYGSLVFGDYITGQTFRGANMVSRVGLGGHGGGALELYTDKLRIDGNVFVNGQTP
DAPYAGGGSGGSVFITCNDLHGHGLIEANGGDGQDDGGGAGSGGRIAIYHSMFDDLHNWN
GTITAYGGKSPIEHGAAGTVFLSGSNGTHTHRILRVDNGDRHLPWAVNRNLGRLTTIKDG
NFGDIRDVGCVTWLHPDSGDTSYMFEQLDIRGNAHLAILPGVYGTAHPLHTVDAVEVAGD
RTGRMHIARNQTVSFDSSDIYFPINAYLYEGGWLNMIPHGRINLREVFIEVNGTFARSND
ITLDKDGWLRITSRGSSPGLSKGAYIISDLTIKPHGTLYPVTHIDYDTPANSVVISLNVS
RLNIRAGGYISTNWMDFTADDVVIDKYGHISADSGGYELGSGLSPGLRQVSGSNGAYASG
GAHGGRGGLARYRVDSPPAYGSTLRPTTFGSGGGRGTSSNRGGGRGGGILWLNVTGALRV
DGSIHANGGEAIVTGSGGGAGGSIWIETEELQGDGEIAVNGGNGKSGSGGGAGGRLAIYY
ANEHNSTQHTAHFTGELQAFGGLGYGTAVRGGAGTVYVHNATVPDDPYNILYVDNNADFV
PSPRLAEVQKLDMSAGQHTTSNVYNSPMGVEVRTNVAGTSYHDTWRLVDGSLTSWFGTSS
GSRVQVDFYMPQEIYLDHALIYPRCDNAYAVRYWVSVYNGQQETQLVDSPVDTRNCLHGV
VRPIVIDAMTTRVKITFERAPGSSWTALNEIELYWSEDPDASAQTQYVTTHGSAWLVPED
DQQFLDEEDHYVFNETHAHRQGSINMEGAGAKLTTHHIEGDNTGVMVVRPRQHVDTSPTH
RDLSNNTGLQTKYFPFSLLVRDDGSFTPPEHVACRSTNITVEGDMALLEHLTIERDCFVH
LLRAQGDDPFDISNINIKIGGHLHLESHHGHVAELQGHNLHIFAGGILDTNDARLFFDDV
EVEPDARITLDGTSYLSPDGSGHGIFAGEGEGATQHSSCTYGQACGIGDSGGGHGGTGGY
GLGQLVEVGEGYGDFRQPREFGSRGGASVFPYIGGAGGGRLHLVVNKTLRVDGEITSRGG
DWVSPRSGGGSGGSLLIETDIFDGHGLLDVSGGEGYGPAGTGIQTIHVAGESGGKSVLLE
CRYGIHVITATYGANCGAEPGSATSHVRELCDQSWFCAYEVSPVAVGDPNPACRKDFDLQ
YKCSSIAQGGGGSGGRLAVYTNYNHYIGQMLVQGGTGPHEPGASGTAYIHKYEVLNSNSS
VAALNRTLYVNNLGLRPEGVVRNTSADIDNTNNVPSVTWLFFERDQVDELEEIHMYGEAD
LAFSTASLDGALTLDTDVLTSDATAQLHIGYNQHILCVNRSIINFHLSVYAGGMLSLGGK
AELTGVTVRLEGVLNNVGDLIIADGSELYLLELYYPDFSSATSFTFRTIEVRNYGLLEIG
ASRDRRTLVGDVVIVSGGAAVRSTNAVIKAKNVTVDAYGTIHANYRGYGADEGPGAGLFV
RGSRGSATGGSHGGNGGRTYYRQMTSPTHDNFLDPQDFGSGGGQAQHSDFVCSAGQGGGF
LHVIATELLTLEGSIQANGYSGSITADGCGAGAGGSIQVDAGELIGSGDITADGGNAVVL
SNRAKYAGGAGGGGRVRVSVANRKYFLGTMTARGGSGAYEDAAAGTVMLYDVNATSIAVD
PLQDAHKTLIVNNRGNRPALPYVNALEELKLSYGEQFGQRKYTLANGFVVTSSVDMPDLS
ALFRPGAVVVRDFLSFQITFTTPVYVYYLDVHSGCDSRYPSSTDVTIVGRKGSITKNGIQ
GGACTGTHLTRIFVNDTLSLVSVSVQSTLPPLHNPKYVALDHIAITKGQDETYNEYPDTA
WDAARTWIDWEGITDTNIHLDEMHVFGGASIALRKSDKYPIAQESLVVDKFVGDRSGHVT
LFDGQSFGALRRNGDDNILPMGIRTFSTSSTLYLPDHTIVYDNDVVVKGELHGLRHLEVS
RNSQFWLAHKDVAVNSHTPRQVNMASIRVLESGELVYAGDAADNEPLSVNLTAFPDEFYG
NTNRSYQGSFVVHGGGTARVSWMSLYTTNFTVEAAGVYDASGGGWTAGLGPGGGTSSAGG
SHGGSGGYACSNGRSKVPGYGNFLAPADVGSGGGPASGMRGGSGGGALRIVALNTVEIDG
EVRANGADGGSNAGGGAGGSVYIITPIIEGLGALTANGGSGTGSCGSGGGGGRIATYATE
DFFVGSFEAHGGSLRIGGAGTIFRQSGNETSRFRQLMVSNGDIGLAVPGLEFTSSDYGHA
WVIFDRDPLTGSSTLKLDLLDIHGQAAVGVCSSDGSGVDMAVSKVQGDLTGRLKVFDNSH
SEIKETPVPFPFSLASGTGSVLNLPSYVHLEGLSYNTVDIGGSLSGVSELEVAKPVTLAF
IDEHVRTLELDALYVSNLGKVQALSAITTEPNLDINARVLHLQSGGSLESKWLRVNASRF
MMDTGAQLTAHGPTYSELADLPDTVRATNVFGDGHGYNSNQGGSGASHGGLAGRSQAFDR
VAAAYGSAWRPSKFGSVGGTSSSGTPGAAGGLVYIKAINATLDGTIAAVGGAGSGASGGG
SGGSILIEADVVTGTGTLDVRGGDASMNDGVDYLINNGNTRVRCASSFVYDNEVHEQCVL
DTDGRWCSTTNNYDTDNKRDDCVGGGAGGGGRIALWYEDYSYDGDVVTRGGQALAENGGS
GTLLLHSVGTNRDIIRVDNGNLDVLVDMAAVNTEAGGPDLEHDGARAVIMSDSTAGSVTM
SLYQLDVRGGAHVVFAPQHPSQMVAVDVDDLEGDSTGTIHVAPKQRLDAALGDSAFVPAN
IVVHANGEASLPGYVQLNDVALDIAGSVLGVENATVGNAGVLRLRPSVDNFALGELHMTG
GSLLSVETGGQGSSSSAATFNATTIRMNGGSRLEADLLTIYTTDMVVSQGAVLDLSGASA
SGPGNGVAFSKGGSGAGHAGRGGSVATVDTGAFYGDVVRPLEAGSRGGGSFGGYGGGVLH
IRATGELRIDGQVLCNGASPQVSLSDGSVSGGAGSGGSVLLEAWTVVGSGLISVRGGVGR
GSQSGGGSGGRAAVYTSVGRSCASLDECPGNQFIGSLDLRGGAGANEPAPSGTFYTMDAY
TTKTSLTINNGGQDADGTNGVSEFVDYSDIEHDKGRTWITIPEQPNVAAVTPLGEVVDYT
FDTLTIHGSAHLAMQLPSGTDTLFVRVVEMVGDAEPTNYGHLHVAHNQVFEIQKSNEYLP
LHLRVYRDGELRLPTRVTLHKNSLYNRGRVTSLSELTVSDCTVTMYEDAAIVPSPSQGGA
QNLVELSRLVLSAGATWLATDTMNTTTFKVDDLELQGYSEIRVRNATIASTKVNMHVDSI
ITAASLGYAPNTGPGTVQGNRYGASHAGCGGRGSTSVTRSQPFGSIFAPVTMGPGGSTGS
QGQAGRGGGAVRISADTVLLEGRIDVSGESVSVDGGGGAGGSLWITATTLHGFGSLAADG
GDGGVYNNLRGGGGSGGIISLSYDETQSRFFGTISAVGGDGFEVGAAGILYTERTQADGN
TYTVLELNNGGRTPSSFPAQAAFDFDDVSHNPAFSYLSFGDDTLNLPGTGAFVYSFDEVR
VGDGAQLAMYPAPGEPSALTATHLLGTGGTARLVIGRDQRVTLPPATSEDEERDIRLDLF
LQEGSIADLPATVELRATMVSQGQLNGLEHLLVGKDGKWNITSSGYTSGQTVPGTYAMRN
VTVLYTGVVKSLSPLSTRLVVDSLNVHYNASYDFAGIPEPARDAPNVNVEKAGRVEGSTC
FWHPVTQTCGCQDQPIDDFNSETECPERPERYCEKGPDCDDFFADVCRESNCTAAERFQH
TCKEDPVYDPVFSYDWQPRTCDQQTNRDDCVSSKCYQYFNNQPCPTGVKLHHNESYVVYN
PCREGELIVDERNVSHTTYYNKLITEEKHDIRSLPYNVTVVNNTAYALVLGGCRFAQDLE
LYLAGELSANSSSPYAGLLFNLTMSNMTDSMLGNSTTGNNSTAGNSTAGIDLTTGYPWPM
VLGPRAQYLNHSSEATCVDDLESWYTYTETRIHNQTYFWNETTVERVYYTYWNITYAISC
DYRTGFTLSPGENCFLEPGEHEYDRLELQGNSYITVQHDATTPTVVRVRDLITRGGSRIL
TNGVASNPKGTPTTAGRGGFHGGFTQHDDDVYGAVTAPSEAGGAGAGDGGLGGGVVRLIV
GEKMTHDGTIQANGASGTGYPLAAGGGAGGSVWITTPKFHGITGVIEANGGKGRNGGYGG
SGGRIAVEVTTNNEYRFEGTLTAYGGGNGAGPGTVFLRDQVDGMWRERVTIAGEGSTTLR
DPDYSRDVAVEELVVSGGATFIVQPNAVITAATLKGDRAGSVDLRDNSRFTVDYFEDALC
NTNFKVGTGAVLDLVNTTLLLGTRNPALEVYGQVLGPYLSLGPNTRAVVHDGAQLDTLAV
VVGKSARLQLDEGAVVGTDGDATTYVLDSLVLQDDSVMRLGTAHPILRIGYFQMGYNALL
DTPDSGTRNFTFICDNAFLGNGANIGDIRRNLLPQG
Download sequence
Identical sequences F2U0R8
XP_004997053.1.12839 PTSG_01084T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]