SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01098T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_01098T0
Domain Number - Region: 287-346
Classification Level Classification E-value
Superfamily Tropomyosin 0.0255
Family Tropomyosin 0.0078
Further Details:      
 
Domain Number - Region: 232-293
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.033
Family Ribosome recycling factor, RRF 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01098T0
Sequence length 426
Comment | PTSG_01098 | Salpingoeca rosetta IFT57 protein (427 aa)
Sequence
MGDTEKSEKPRRERRERRTADADEAAENPFGAYMQSENVLDKLKLLKYEQDFCKKFSMKP
IHRYYFAESTDPNEQLWYFANLVSWLLSFLKQRYKAPDQYDDPNSIVTSVMMELRKAGVS
VDVSQSKLKTGAGEEICQILNQLGQMALKSLKWTWGKPIHKHEDFQEQEDEEEAVEITTA
DMEAEEEIEEEDFDDEADAFIDGGAMAAEVAPSSERAEVLESNVTAAEWKIELERVLPQL
KVHIRSDAKDWRTHLQQMQDNKTQIEGALKDTTQHLSKLEKDIAKTLEKIMSREKYINGQ
LETLVSEFRQQQDSLAATQERYKQASTTVTEYSRQLAAVSADLEAVKSQMDERGSSMTDA
SPLVKIKQALKALKTEISQMDLRIGVIQHVLLAAKVRQKGEIVQDMNADTSANNPFAVSD
DDSAWP
Download sequence
Identical sequences F2U0T3
XP_004997068.1.12839 PTSG_01098T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]