SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01337T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01337T0
Domain Number 1 Region: 182-527
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-95
Family beta-N-acetylhexosaminidase catalytic domain 0.00000487
Further Details:      
 
Domain Number 2 Region: 34-180
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.000000000000698
Family beta-N-acetylhexosaminidase domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_01337T0
Sequence length 573
Comment | PTSG_01337 | Salpingoeca rosetta conserved hypothetical protein (574 aa)
Sequence
MAMVSVLVVAACVVVLSVVGVRGYQDDGTRAARPWPPVKTWNKSASGSVATLNPCTFVFT
DKSAQPSGVERAIDLYKHVIFGNAGPCTSEDKARMLAGGDVLTGIEITAQHPIPGVAKNH
EDYALEIPAGGTAMLTATSYEGVLRGLETFSQLVLHSALQPNDARTWHVADVPLQIEDAP
TFGHRGLLIDVARTFLPVPVIKTIIDGMMYSKLNILHVHLTDSQAFPLQLHQNPEITFHG
AQSADMVYSQDDFRELIQYATDRGVRVYPEIDSPGHTRAMGLAPTLHDIVSCANVSNWGK
CCNEPPCGQLNIASQHMMQVLRNVTSEVAALFSDEYFHLGYDEINFNCWKQDASVQRYLK
EHNVTINELLLTFFKNQRDMLHDVAPAKKRLYWEEASKQNPPLPLDKSTIVQVWGPPATL
HEVLNDTDSDVIVSTSTDFYLDCGLGNMFGQASWCDPYKTWWHMYSHDILANVSKSDASR
ILGGESCSWGELAGPDNSLVRIFPRASAYGARLWQYANTVSQREANLRIADHAERLSRRG
IPVSGTTLQYCRLYPDMCYGFLDNKQHDGNIHR
Download sequence
Identical sequences F2U021
PTSG_01337T0 XP_004997310.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]