SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01378T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01378T0
Domain Number 1 Region: 965-984,1019-1064,1391-1422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000145
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 848-879,1129-1180,1306-1385,1518-1538
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000863
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 
Weak hits

Sequence:  PTSG_01378T0
Domain Number - Region: 2804-2843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 172-207,523-553,960-985
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0118
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 2456-2486,2727-2814
Classification Level Classification E-value
Superfamily Sialidases 0.0167
Family Sialidases (neuraminidases) 0.022
Further Details:      
 
Domain Number - Region: 3347-3423
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0494
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.015
Further Details:      
 
Domain Number - Region: 634-717
Classification Level Classification E-value
Superfamily Sialidases 0.054
Family Sialidases (neuraminidases) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01378T0
Sequence length 3468
Comment | PTSG_01378 | Salpingoeca rosetta hypothetical protein (3469 aa)
Sequence
MMFVLVAARAPRAVLAQAPLIAASFEAGEDTIAWTGGTARTTCGRNAFIGNSDEIIYTNS
ITTPASSSLLQFEFFAGDACGVESSSLLSLRIFFRQGSSYNEITSCSPSTSSSCSTGILF
PGPTYPSDFSAGNWVRINLPLPPNIQGELVFRVGSSVTAQWGIDNVYVGSGCANGCASAG
FCNLTASVMPTCACDAGFVPHPTLGCVPATAPPTTLFEQFEDDIDWEVNGGRITSSSACG
RAAYGNALVFDRKSERRRALTPVLDARSAARINAIVQIGGEGCEEPDNIAESVVIGYSLD
GGATVIPMRILSYSSFERGGYVSVAIPEAARTPYTRFAFYQFAASGTTTDFWSIDGVSLQ
TSVPLPRIASALTGPVLNTTEFVSAAGTRFTSLCQRNGLVFSPTSSVQHLITAPIIPKAG
TMMQFDLSFGCTPPTTSFTLRLERSTDGESFSFAGTSNCDIQLSACTSWSQYETQMVASR
FGGGWHRITLAVPPSSAPTQFRIRAYTQANSAWAIANLYIGNECPFGCGGLGTCVSGTCV
CDEGAVSTSDNSCGPASVNTEFRETFEDGLSPAHWSLVENAAIASDGGGCGVVSEGKSLF
FGKGSYRTAQTVDLDLRRGTLVHATIKLGTQGSGGCHSPSASSDSVAMAYSIDGGLTWTK
MRFFQYDNYRTPFVHSTVLPEEAKTRRTRIGWFQQYPDGNGQDEWNLDNVYIGYKDDNTV
TAIGDDFSPLLVPNWLFYPSFRVSDQCGRASALVSQAEGAQATTRDISLNRQVVTAFEPS
LTASPSSAEWAAVKGFRFTKACGLEASGWLFDATSGDRHAETVDLDLSSSGLVLEFDFGY
GAGNCDGPESPSEYIVLEYSVDGGSTWQQLTSPLGASSVHRYSYRLDNYPSARTTATRLR
WRQNAYTQDATSKDVWTLSYVRIQGVPNSDPVLFVEYNLGCGEGSGEAAFAIDYSVNRGQ
SWVTCSQCSPTPNGCSEWPQHGECTFTTDTSPRNTWRRLSLPMPNADTVRFRLRALSDVP
VAFDNFYAGVQCPSRCGGHGFCTRNGTCVCDDGFVLGVDGSCAPVPGAHPSLLVEDFDPF
VPAQWADATGGVVATNGACSGLAGGNKMVFKLGQRRALVTRDLNLQHADFVEFVLRLGDP
ATSTCTAPSVSQEGVAIAYSIDGGLSFAKIREFQAGLYSSATHFSVALPDNAKTPTTRIM
WLQATGEDNVDVWAIDDIYIGPRRAATPSHLFQSFASPISRDLIAITPNGELAELCGQPA
LVFSGSQRVNGESLLTTTTIDLPQNAFIQLVLSTGCGAPSADFRVELERSVNDGASWSSE
HSTCNPITSTACSSWSVLTDNRLLSRDWASGWHRITIPVGASSHVRFRLRASDAYSSSRT
WALRSLYIGAGCGGDFCGGHGTCINGTCTCDDGFSLTDAGSCSVSTPLPRQLFESFEAPL
SSRFWRQQPNGGSFDTGNSCGVVSSGRAFKFYGTSTRKLESNDLDTRAADFIEFNVFTGS
SSLSTCPVITREAEGVVVAASTNGGITWTRIGTVEYYSASTLPRRRAIPIPANFRTGSTR
FLFWQPEFSPNYDAWALDDVFVGCADLQPKQLTQLFPSLPLPRQFYPRQVNAMATEVCGR
PAMSFAPASFQSLQVGPLDLDDKGAFVQFDLSTSCTATAASGYDVLLSQSNTAFETASAL
LQVSCEPLTSSSCKSWYWKMNEVSFSSHQLANGWTRVVAPISSPTRGLRVRISTDVTLSV
SGRTLAIANLYVGSGCGGGCGPFGVCINGTRCECDAGFSVDAADNTCRRTSPRKGFLETF
EDEVLASRWSKVVGGAFQTSPCGPLAAFNSLYLGGNTRQRFVFTQELDLRGAAFVEYVLR
AGGSGCLAPSVTQEGLVLGYSLDGGVTSSLLERHSYASSTSATQHIVSLPDEAKTQHTVL
GFTQPNADGLNVDVWGLDDFYVGPTTASLPQHVEIHFELPRWDTDHFLFAPNAQVKTHCD
KPALVFTLGSGVGLAWFETNMLDLQEGAFIQLLVSASCGSVGARRDLRLTVESYDLGDSQ
WRDLPAPCNPNAAFNCDAFGLPAGSNLRVTDYGSGWTRVTLPLPSVASGRRYRFRLSWLQ
SATVAITDVYIGSECPFACGGYGLCKNGQCVCDEGFVPHAERGCVQATGPPQELREAFTS
APLSPARWHRLSGGAVLADGGGCGTIAAGGSVHFNADTARYLESVDVNTTSARFVEYTIQ
TGNSAGSPCRYVSHSDEGVVFAYSTNAGYTWHVLEHGRYTSPTRRFVSLPEGARSPYTRF
LWWQPEFSAADYDTWNIDDVYVGPPGSVTPTAIVEDFGGNGDGDADGYDAVNFVTVRGGV
TESFCSSEGNALVFKEQAVSEFLITTRDVDLQPEELVVLMDTLSTPASSSWKSVQGRRQA
KDCGLTTSGWVFDGLGFVRVAETEPLDVSPTNLKLAFTFTFGAGGCDSPESSARNENVFL
EYSIDNGQNWKSMMELKYPTHQNTRVSLALDDAAPDRTATTKFRWIQPTFTEGMDVWALA
DVGVAGTPYTTYYLQFDLATNCEGVSGSTDPITASFSAGLMGNFIDLQQLTCDPTTVACS
EWQHPGTIFGNEAYRGWRRFTFELGNNPSAHYRIAIARDAGAVNTFAIDNLFIGGLCPGM
CSGHGRCTLAGRCDCDEGYTGTRCETPSARLPQSLAVDFSSGSVSASHFSSWTGAVKVCR
TGMVGLVFDEDGRHEITTRDMDLSGITEIKFGFARCNVRSETVAVSASTDGGVRWKMLGR
YSPGSSTTEVTIPLEGAPLMRLRWWADSTDSNHPWFISHISVQGECEATPDLCSGSNEVC
VNTLDGHTCECADGYIRNDNDECIKDLCMDVTCTASDDCQKPGECNPETGRCGPTIPLSG
MQCDDGDVTTFNDTCVEGMCKGTSLCEGVTCPSAGQCFVRGTCNRMTGECVPRYAPNGQQ
CNDGNMNTVNDTCVNGQCVGQLDPCLNVSCTGTPSSSCYSALACNPDTAQCEAAGPLTGT
PCNDGDATTTDVCINGECVGTPKCSGVTCESTGSNMSCTTSRCNPLTGLCEAVKKPDDSV
CDDNNTNTINDHCVNGMCVGQDTCANVDCSPISACHDEGTCQQGVCSTPLLADGTQCDDG
NAATVQDACRNGVCVGLPNLCLNSTCAPVGECQQQSPCDPLTGVCATRNATDGALCSVGT
CVGGRCVMSTPQCDTRTCQGSGPCVENSCVNNTCVSVSLQDGTGCASTLVAAGVCSNGTC
VDLCAGVTCARQQCHTTPGCNPMTGSCVSTPVLDGTTCNDGNNTTVNDKYPQHFDGMACD
DEDDGTDNDMCLNGVCRGTMKSTCTGAPNYVECTQDGRTGFCFANLCVIPPSTTTITTSA
PESTTTTPTTTTTTTTTTTTTTTTTTTTTTTTSATTTTTTTTTTTTTTTTTMTTTTTTTT
TTTTATGTSTTSAGAASTAAESTTLDASKSGSEADPLPIIVENTGAPP
Download sequence
Identical sequences PTSG_01378T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]