SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01383T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01383T0
Domain Number 1 Region: 107-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.17e-21
Family Clostridium neurotoxins, the second last domain 0.017
Further Details:      
 
Domain Number 2 Region: 1405-1441
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000895
Family TNF receptor-like 0.0057
Further Details:      
 
Weak hits

Sequence:  PTSG_01383T0
Domain Number - Region: 1323-1362
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000259
Family TNF receptor-like 0.0028
Further Details:      
 
Domain Number - Region: 925-958
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000392
Family TNF receptor-like 0.0061
Further Details:      
 
Domain Number - Region: 966-998
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00118
Family TNF receptor-like 0.0083
Further Details:      
 
Domain Number - Region: 1364-1408
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0297
Family TNF receptor-like 0.0078
Further Details:      
 
Domain Number - Region: 844-882
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0565
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number - Region: 1288-1319
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0753
Family TNF receptor-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_01383T0
Sequence length 1806
Comment | PTSG_01383 | Salpingoeca rosetta galactose-binding lectin K chain (1807 aa)
Sequence
MSSRLNLPRRSGKKLQLSTKDKSVEFARAASLYSTLANATEPDYFVFAPVSSPSYRVHHR
ALLSATGDRAPLELVNNGRQPASAMFLRVYPFRSNHGLPCDGSTTYQDEVARFEFEEGSG
TETADTSFGRATGLLSGSISWIKGKLGAAVQFNNPSSTAQTPIISIPSYWAVVQRDFTVS
FWAKLPSTATVSRPSSSVYAGLEAGRRWLIFPPHGEYGLEDVSTAGFGVSLGANALGVYA
HTSNYIPALLYFAFPSKLAGWHHFAIVVRDNTPALFLDGVAVAQGNRAKYTVTVRLDALG
SARGVFLGGLDDLRVFDRPLPAREIKAVFEKEDSLSGGGCVVVDEHDAATLTCSGGADNV
IADIPFASYGTPTGNTCGDWTPSSCHSDTSRVVVLNECAGKHSCTVHASNTNFGDPCYLT
FKRLAIEFTCVNKAQMGDVAVACAQADAGDTATLTCPAGLVVSSIDFASYGRPTGTCGKF
QADESCHAPTSESALWDLCPGKQTCTVPTASSFAGFSCSGSQPLQLKAQYTCRSSVLPEA
SCVTVLEGYSQTITCPANTVIAAIPFASYGTPTTTCGQQELGECHATQTASIVKALCLGQ
SSCTLASNNGVFSDPCLYTYKHLSVQYICAGVTIDSVDTCKPVSACPPLWEEVVAPTPSS
DRECAPCADDGSEYFHVATGMCAPVTHCLDDDQYEAKPPTASSDRVCLSQQACTEGQEFE
SVPASAATDRVCSKCDVCPDDHREVAPCTLTSDRRCEACGTCDGGQFEEVPCSGTQQTVC
RDCTVCTPRQYETSPCQLQSDRQCKDLHTCSRREYETISPTATTDRACARLQVCEDDEFE
TVPPTATTDRKCQITTSCRPGEVQKLPPTATSDRCFPCEAGTADTDSNPECPDGTEEASA
PTTFSDRRCRRCQAGEEVREKDDPACRPVTDCPAGMVESQAPTSSTDRVCSPCAHDTFKV
NAGQTPCRPVTDCAPGEYVISTPTPTSDRQCLPCEGDFVQSASFHGTFSDARNAHACREQ
TTCEPGAEYQTKAATPTTDAECERISTCRPNQYIAVNATLTSDVVCELCTVCPSGHTTAQ
RCGRYSDARCQNCGEECVLGVSYQQRPCTASSSRVCKKCTPCKAGVEYEAQPCTLHNDTL
CRPITDCAADGAHFESQPATASSDAVCSSLMQCDADVEFEAVAPTPTSNRKCARISPECT
IGSEETAAPTPTSDRVCVPCPAGTSWVDGECESCAPGQAAPSTGNAGACAERACPAGTFS
ANPTEACTPCPLNSYQNEEGATSCKPATPCSSGEEPVVGVTRFHDRQCSACRPGWFSPGN
VTACTAHTVCDAGQTELAPPTTSTDRQCSPCATGTFKAVPGSHTCSMPRTCTAGYEEAAP
PTLISNRVCRACDNGVTFKADAGQDTTCIPVRICAAGMQEKYPPSLSTDRECEPCPSGTF
NPDGVNVQCRPAAACSAGDYEQVAPTVTSDAVCVDCNSQDGFDDDSDPTTSCKSASTCDP
TTEVESVPLTPTSDRSCHRCSSGETFQAGNDTRACVHVPCPNYAVETAPPSATSDRVCTS
YIQFVLDEDYDALILGPEDEQRLAHTLRLWLAGVGADVSHIQRIDVTAGSIVMTVVTNSV
EVAEEVLYLRCTYPPALLFKGSMHQTLVNCTGANATATPGTQAPASSSGTSTNSIQGWTI
AVIAIAVAAIVALVVAVVAWRKRRTRKQDLDLSAHEHQSRVSFENPTYMYAPDDDGTPAH
VVGYADPDRHGMEEGTGIYDRVGALGFEEDTMHHRHGHGSEQLPEHEHGYMDVAPAADEP
SNDTTI
Download sequence
Identical sequences PTSG_01383T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]