SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01413T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01413T0
Domain Number 1 Region: 263-509,579-610
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.44e-81
Family Type II chitinase 0.00000896
Further Details:      
 
Domain Number 2 Region: 510-577
Classification Level Classification E-value
Superfamily Chitinase insertion domain 5.8e-17
Family Chitinase insertion domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01413T0
Sequence length 817
Comment | PTSG_01413 | Salpingoeca rosetta oviductal secretory glycoprotein (818 aa)
Sequence
MGWSAAAAALVLTVLAGCTPEPTQAALPPRGGGPYLAWPTTRSDPGNFDFNWNGRFDAGG
RDVVRNNTPNDVWPSRDSAYTAARYGYCGGVAGSVPDFLTPETVSATLTPGQTLNMTFIT
DEDTPPGHVVFSICDRATNVSQECFNEHLLRRVEDGNLIDFSWDERFFVKPGFGVYHPTF
HMPEQLTCSHCVLQWHFVGAGECLPHGYVSFGFPAEYGIDKNKPACGDVFPEEFWGCADI
ALLPQDNPQGLPCDDEDQSGCMVVLGYFASWSYHRPAPYTFMIEHIDAGKYTHLAYAFAG
IDADYTIMPGEAVDVDGGRYALFHTHVRQRNPNIKTLLSVGGYTFNADSRTQYRFSTMVA
SQQRRATFIASLIPFLRTHDFDGVDIDWEFPGYLQNGGSPQDRDNFLTFLQELRQAVNSE
VTQKDALIVTVAVSAYRGIAEQAYHIREMHKYIDFINLLSYDLHGYWEPQTGAHTALSST
DGIDVQDSVAFWLEQGTPRQKLLLGFGTHARGWTLDSPANHAIGAPASSPSRPGPYTDEA
GLLAYYEVLEFEQAGFITRFDNLTQTMYTYYGDQWFSHDSPFTIKLKAEFALSQGLGGAM
VWSIDQDDFLYGSPLVQAIRDNLPISPPPPPASDGDPPLNLTEIIIIAVVGVLALIAFVV
LFASCNKHALSSKPTLDNSGVGAEYDTPVPVIPVLKLSEDDLESETSTDDSSNGTDGLPR
RRRRLKPRYYDLGEMEDEEDPMQKAEDYVTTKDGVLVDTDGRMVARFHDGEHDEIYDYDQ
RRRRETDAAHRRAQAELVAMRNGKYVARHYDDEDITV
Download sequence
Identical sequences F2U099
XP_004997388.1.12839 PTSG_01413T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]