SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01465T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01465T0
Domain Number 1 Region: 767-900
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000385
Family Cadherin 0.0085
Further Details:      
 
Domain Number 2 Region: 1311-1350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000331
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 3 Region: 1096-1197
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000357
Family Cadherin 0.0077
Further Details:      
 
Domain Number 4 Region: 1362-1470
Classification Level Classification E-value
Superfamily L domain-like 0.00000000051
Family L domain 0.027
Further Details:      
 
Domain Number 5 Region: 1506-1600
Classification Level Classification E-value
Superfamily L domain-like 0.00000000257
Family L domain 0.037
Further Details:      
 
Domain Number 6 Region: 1621-1669
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000085
Family TSP type-3 repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1661-1702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 995-1095
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000107
Family Cadherin 0.0085
Further Details:      
 
Weak hits

Sequence:  PTSG_01465T0
Domain Number - Region: 325-356
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000349
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 
Domain Number - Region: 685-771
Classification Level Classification E-value
Superfamily Cadherin-like 0.00359
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01465T0
Sequence length 2164
Comment | PTSG_01465 | Salpingoeca rosetta NOTCH2 (2165 aa)
Sequence
MPKPVTKKHVTPQEIVEICACLRNMRGQGTLTEKETLLVLHVYMQLKLAHLENRRKSKGK
RSNGQVDERAAKQLGVGLSTVRRKYAMLNKLLQEHGIDGLKTLSVENRRGKATQLPTRVP
TTKRVLRQVRDHVRMQREGGHRITAVQVLDFLRKHRHVDVRPSFAGDGDDELDRAAALRA
VQRFLRRAGYLRGNKHVVQENPRHKQLLAKYLKEFDANRRLPPDERLREVYLDESYIDRN
YNRNRDSLYDPNDGQDMHSHRKIKRGRRYCFALAVQGPDPRVCTVSDRNDRALAGPVPGT
SWIFDPGSALQRHTRKKCPVAEEDLPQQPQKQPSTRKCGRCKQPGHTRKKCPVADEDLPE
QPQQQQGRPRKPPRGSFHTGDYHKAFNSDNFISWFKDALLPNLHQPSLIIMDNAAYHCTL
PPDTSVPGRMKKADVIAALRARNLTVSETDFSCELKDRLKLWVKNHVQPEVVQLAEAQGP
QGALLPSVLQRPQPNRARVGADQGNVGRRYSLDTTFEDVGRRLEEEIQRLAEDRGQYRKD
GKTRVQAIIDSIDKQLERQRRIIDGRGEEEAVEQAAPCTTTRAASADSTDEMDVEKAAAV
VLDEEVDWVDERMDEGEDGEEGEEYNNELVLRSDAAGVLDFETSPTVEVVVTCTDTTPQR
LNVTQGVTVRIGDVNEPPTGITFDGELREDAAAGMLLGELVVADPDVNDTHTIAGVGMDT
RLQLRGNLLYVRDDAATLFDYETEPLLHLHLVAIDSAGQFVQQLVNITVEDVNEPPVDVT
LTPTQPTVVENTVPTTRIGQLSALDPEGSGPVTFRSGVPAVLAVTSDGNVTLVAPLNFEE
SSGGADGVQWFGVVAVDATGLETEARIPIRVTDANDAPVFTEPAQDNAFITAPENQPVPV
DVGVVDEDLSDDLTLFLVEDPEATAVQITPCAGRTSPFTPCNATFTLPAQDYEGLVASTN
DNKRTYTLGVSDGTTTTTTNVTLVVEDVNEPPTLALITTTVQENTPEGEQLARVLVTDEA
DQTATCEVVSPQSQFAIDSSASSSSSMANGSEVVLRAGAEPLNFEEAQTASVTIRCVDSG
VPQRETTTTFTLTVTNANDPPTRIALSPTAVSEFASVGSTVAHVWAEDEDADAARFHRFV
ALSAGDPPFFVFGTSLVLSRRLDYETQRSHNITIRVEDTAVSPPLTLTQTLTVRVINEVD
CDATRCFNGGTVSTSQVKGLSACAHPGTGFRGDVCDEPVMCTAVPPPNAALVVNGSLVDG
DDASQQLAFMEQVGVACLQGYTTNGLVDGPTTFTEVCQDNGMVSSTASCIDADDCLAEPC
LNGGLCEDRVAGFYCQCPSGFSGDRCEFARDCFLDQAGATATVTTYEDLALLAECRVFHS
NVTISITAAPANATGDDTANATIAHLASLSNLQRVAGVLALRNNDHLVSLRGLANLTWVG
GLVLENNAQLRTVSGLSALTTIDGKLVVADAGPSTLQGLEPSTCGSVIIRHSSLVSLEAV
NLPMWLQGSFVLENNDFLLRVNGLAAVLQIAGDVIVRNNLRLMTLDGPSNLARVDGDILV
RDNTVLLDVGALASLQSYGGSWVIANNSNLCFIGPFLLENIASLEVNSDSEEFPDVMLAR
DDCPAERADTDGDGVFDDKDNCPRVFNPQQRDSDSNGIGDVCDCNEGSDAFCANGGTCVQ
DAQARHYMCACPVEFEGPTCNISSVYPVPQMQVEHSALFQQQPVRVSSVAFTQPYLLLPG
TNPEVITDSATTDTVTTRLSAAWASLQAEEDVDVPRQPAHDVVATLLSASTVWFDAPHVW
VHLQARDASFNMRTAATTVSITLSARVDTDGDGTKKDVSVQAWCEMSAASSGCITWTSVP
QSWFPLENSDGTPAAMRAVTVAYGIGASLSASAFMQELPGQLQLASRPAITARVRNTVAV
LVPFAPVYREDTTQLAVYAQADRGVSAVVLRMDMIDSDALRFVRVVAAPGWSARTSTSGN
TTLAISLQRQVQQSGGGGSSSYASPEVLCTIEMAVMPQAVEGRFSELQATVVGFVDLQGR
NLQLEGFYPLPSPALHLHRNRGVLASKSIGYVPVAANTLVALLPHLAQAELINTARLDGN
TVSTSLSRPTTRPLAGLRDHNCQPVYEDVFLDVSIALALGSPPSQLCLYTMYLSLRDDLW
NVYA
Download sequence
Identical sequences PTSG_01465T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]