SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01519T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01519T0
Domain Number 1 Region: 371-434
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000528
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 2 Region: 313-377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000375
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Weak hits

Sequence:  PTSG_01519T0
Domain Number - Region: 428-503
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000108
Family Complement control module/SCR domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01519T0
Sequence length 594
Comment | PTSG_01519 | Salpingoeca rosetta hypothetical protein (595 aa)
Sequence
MCLMCHFHMTTAESQHKLVDGGAAKVYGFTSFAQEFNVACPNGQGFQDRKWRFLCEDVGY
GPNDNVAKFGTLEDRKENYDHPQTFKFIASDNRVITGETSCCREYCRQYILVDCSPFYEQ
HDTGCVPTELKPSPSPSYDEHFQQTFFVTCHNNQGLVRVRSDYDEGQGDRKWRFQCAPVG
STQVADLTEMSTAGVEDLHGAVNMICPTNYYLRAIQSGFVQAMKDRLFKFQCQRITGAIL
TNCQRREFVNPVHGALDVDVERHQVIAGLASMYSAVDEDRRWHVTTCDVSCANGFTSDGA
RGCIEAPCGKLVLQDGILSGNCQGRVGDECQYSGCNLGYRLLSPPVTRVCQADGSWTNTA
PVCKRIESCGPQVLPNGHVIGACDGGIGDACTFSGCEDGFKLSETGVTRVCQADGTWSNS
PPHCERVPCKPLTLQHGQLVGDCGGDFGDTCVYRECNDGYSMLVPVGPDDPVKSEGTEFK
HATSPVSRTCMGNGTWSNGTPICHRTPTTWFHHIPSIFWDTMQILWKDITLVVEGTCHAM
DKLQCWLQNVDTRIVWAVGSTCVLMLLGLYWFDAPLPAANEAAQNSGTARALTT
Download sequence
Identical sequences PTSG_01519T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]