SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01572T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01572T0
Domain Number 1 Region: 6-119
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000000453
Family NagZ-like 0.018
Further Details:      
 
Weak hits

Sequence:  PTSG_01572T0
Domain Number - Region: 164-204
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0022
Family TNF receptor-like 0.049
Further Details:      
 
Domain Number - Region: 296-337
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0565
Family TNF receptor-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01572T0
Sequence length 440
Comment | PTSG_01572 | Salpingoeca rosetta predicted protein (441 aa)
Sequence
MARTRSLKHFDAYSVETNRVAFNGNISTFDLWDTEVLQAKALAVMSSYASTNGVPSCASN
MLLNDVTLNGGADMELGETYFTTNGCLEQVVQHNGTTIDTVNNTVRRVLKDSFIMGQWYA
SMSARPVDPSLPSSHGRCISECPDNGEYELSNTRHQLPPLRRQPHQSRIAHCPLDYYAKD
HRCVPCTTCGMGTWASTPCSASSDAGCSPWTECKPGLEGLDVVLEVCCSGQGKDGIHATI
RQMDAYAARRSCPGCTDTCECSAGFILVYDADSADCRPCDGVTEFSPSVGGSKYEPIEEC
ERGQEEVAAPTRCSSDRVCHDCPAGTIDSDSDGSTGCEPHVQAMTLLISDCVSATSARRA
RTRLSLASQGVPCLPVTTCDASEEETAESTPTSDRVRSLCELDATFKSVDGQAESCRPVT
QTRACLCRVRGLGVHFHARP
Download sequence
Identical sequences PTSG_01572T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]