SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01615T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_01615T0
Domain Number - Region: 295-325
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000432
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number - Region: 397-442
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00104
Family TNF receptor-like 0.0095
Further Details:      
 
Domain Number - Region: 269-296
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00647
Family TNF receptor-like 0.0086
Further Details:      
 
Domain Number - Region: 331-358
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0824
Family TNF receptor-like 0.0069
Further Details:      
 
Domain Number - Region: 465-511
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0918
Family TNF receptor-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01615T0
Sequence length 1332
Comment | PTSG_01615 | Salpingoeca rosetta predicted protein (1333 aa)
Sequence
MSSPSLAQLRPCFVWMVVVVVLVAQLLILEVASEPPQGFTDYENTEFGSFDFTCPQNSIL
VGFYAEPVGVNGDRRQPSNPRDTVNQLCDDGPMVSVTSQYNGPARDRQFFVMCAIIDSNI
YNMKNCRTENNGNFLNTVGGTVSFEAASDRYIIKLESQYDGATMDRRWKIETCALSCKNG
VALTARHCPFDASRIQVTYDHPPEVGTMSTYTCSADGLQPTIVFRGDEYIGSDPSFTPST
LFEGDLHISCYVDDLTGPVQRDFEFAVCQVSEQCDTGFFLSGDCSETTQSVCSPCTDCAI
GEHVVQSCTPEQPRTCTACEEGKFSVDINQDGCQVCRVCPDGQYATGECSVSSNTPCEDH
TTCGLGRFICDAGNAFKDNECCTCTDGKFQDNPSIFAEKCTPVSTCPAGTYIEVAATPSS
NVQCGSCMPPFQYSTEENQEECIDTLVCSSTEVETAAPTSTTNRECARCSSGYADHAIST
TDCIAWTECLPGEYEVAPATFSSDRQCMGCSATECLPGSFASTLCGGTHDIECEECTPSC
DTSEFIAAECTPTSDILCLNCNEADCDDGQFATCDGVDAICTTCVRCGFGELETAPCTIS
TDRECLRCSGDVCPPDKYLTGGDCANPTCTNCTVCDPDTAYQFAECRLEGSPVADTVCLS
LSTCTSGESFELLPPTPTSDRKCVGLLFCDPDSEFELLPPTATTNRVCVECSQCRDNEYI
GTPCTLTSDTECNLCSVCPVGFTETRTCQHNVNTLCEDITKPVIVTDSTPIIVELGTNYN
GEGIRATDAVDGELPFSVEGLDVRRTGSQSAMVVATDAAGNRVEVLVPFVIQDTTPPSIA
TSVPSLYVVPLSELPALRSGRRQLFSFADFDLQSTSVTPAVETLPPGTHAVYASAADGSG
NTAHALVTVAIPADDESAFVYTQQDVLVSKANVTAGLATDAFVIGVQTLLSEMLAGQDVT
VVVVDEPEGGLIQDGNGSGGNALSNGGADTESNGSDEGTGGDQRTRRAQADLVAVTILMV
FWDNSTFAWLPPEDVLALLQFDSFSVQGVTLSLSRLPIQAGPATTTAPNMTTTGSSTTNT
AGTPAPSQSGLASSQITIIGACAAALVVGAVIAVVVIRKRRNANDDGAPSNNKKRKKKHS
VQAPDNTVHTIQNPVYEPERGSALLTSGYVEPDRADQQGVYAEAAFPFGAPTGGQQGGDR
FYEAPVTSTKGLPQKQSSNTKAVQRQLESTYVESPFGMQVEYGTLMSPPILDSTTHNNNN
NNSSSSTTDGDDDLYEQPVTNSEYLEVVEGDTLTGSGQPPQAEYEQPDGFTDANYETLEE
SRGRSLMDNIFK
Download sequence
Identical sequences PTSG_01615T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]