SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01760T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01760T0
Domain Number 1 Region: 16-177
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000136
Family NHL repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01760T0
Sequence length 181
Comment | PTSG_01760 | Salpingoeca rosetta conserved hypothetical protein (182 aa)
Sequence
MDCRVRVGNFKWFGGVLAPNGLIYGIPSHHSSVLIIDPTDNSADITTMSGLGALPYKWNG
AALANNGMIYASPRDSDRVLIIDPSTNTADNTTIAGSSALRESSNKWFCNVVLGDNRVLA
VPLQGTAALVIDPATNVVDTITIAAIPPGTLNWGGCVLGDDGAVYAVPSHSSSVLVIGTH
C
Download sequence
Identical sequences F2TYW0
XP_004997740.1.12839 PTSG_01760T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]