SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01807T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01807T0
Domain Number 1 Region: 2118-2214
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000514
Family Cadherin 0.0045
Further Details:      
 
Domain Number 2 Region: 1848-1927
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000129
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 2515-2604
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0066
Further Details:      
 
Domain Number 4 Region: 2218-2314
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000428
Family Cadherin 0.0025
Further Details:      
 
Domain Number 5 Region: 2404-2507
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0000157
Family Phase 1 flagellin 0.014
Further Details:      
 
Weak hits

Sequence:  PTSG_01807T0
Domain Number - Region: 328-352
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00541
Family TNF receptor-like 0.0033
Further Details:      
 
Domain Number - Region: 1212-1286
Classification Level Classification E-value
Superfamily Tropomyosin 0.032
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01807T0
Sequence length 2890
Comment | PTSG_01807 | Salpingoeca rosetta hypothetical protein (2891 aa)
Sequence
MATMAQWWTVTAAVCLVLAATLLPERAEAACSTTLPANADFLCLQPTALTGLNPTCSNGG
TLSVSTYCQFENDPSRWAASDCECECPTQWSGPTCTEPGAICEGNYTCLRGTCESYRKCS
CPPEWTGDQCQLQCSCKEHHTPAVCGPGCDPVGGYCNTPGECSCKEHHTGQFCDVCEDGY
YRSDDTGLCIPKQTQGYCDRKDAAATYVPVTGVCDCSPFEWYGDRCDIECQKCPDGERQV
GGCIGNEPVECGGCSPCEDGFSYRVSGCDGSTIDSICEPCNQCSPGTFANGGCINGEDTL
CVECTECAEGTFLSAGCDGIEDSVCGECSTECPDGMFPVAPCTPQHDLRCADCLPCPEGT
VTARFCNSTHESVCLGTVEIPALPAVYVQQETRLLHLRLGKRSPAPFTIRMSGVGLQVLQ
SDRTNFNGESNFGDTMQTFDLQIDANAESVPFTITPHATGQQPVQFSYPDNVGATNYVDI
TEETRNLFGLIQIDEGSSVFDDFGVEEGEVPTGTHTLPVTILSDQVEFLAVDPWQSMGGN
THQACSFVSLRLTSSVTLPISVRGLRVTTSPFSIVVPDESVCADGSLSVEQLQQLSTTSS
LPQTFMSALVVLVLARPSFPLLLSDQVEFLAVDPWQSMGGNTHQACSFVSLRLTSSVTLP
ISVRGLRVTTSPFSIVVPDESVCADGSLSVEQLQQLSTTSSLPQTFMSAIEPSLPSWLRI
AVDRDFSADVTVESDFFVKLIPGPEVTSIPNCNNLPVFSNSYYAVVLWSKASVILVDGSS
QSVPAQGQAFCIAVDVAAYPGDVVFMRVPKAAWSLLNALPFKQRLDSSGWIIGDTSVGFS
RNSHLQGAPTIEFFDGEHIFKYNTGGLDFWLDTSLSKTLLELGSTSTLGLKVELSVDGVA
GLSSDNTFTNMNQITAGAWEGYIEGEVNLDIKFSILKKTAQWNFKARGAVVGSFDGDSGT
EPAPRDNCGPLANPKGIFVTVTLSMRSSGFGNKILDSALGDFLGFGAEEEFSLKYFILYK
SSYVNGVWQEGMAGWGFRFDIGKICYFPGICARTLVDLQYSDSDVLAPCDVFSDLYRQLP
AGKVVSIRGTVVRPQIAGLFRLPGDASVRLVLSTTEFAYLSQTKCTATLFGVSVETNFAT
GNYPQLFFRTNYQAKVFNLVDAELDVSAILPAFDSRTLIDWNSMALSVRGTFVGDFVEAI
MTAVERVLRDWINKAVERFESVKAVFESLKQKLLQFEGVIVRLQSGLARARQLVDGAKQT
VQSWQDAVDKAREPLQEARERAAYLRHRIASICTIRACPDICIPGCEFRRRRRRVAMDSL
ELEEEIRHPTRSKQLLANHKQGHALLVRQRRWGSIRIPKLVCSSCLWRIPNVPCLIANAI
CRVLKATLLFLLKVIDALISALLLALEMVEKALDAALVFLDSASFLFDLAGTSCDLVAVD
VVKEAVRGALELGVALASASISDVIGIPNMGFELVVKGFTPREFSASMDIVLFKSTSIRL
NVFINFADIFRSIARVASDLFDRFFSSFFRRRRYARGLGVDVVTVAHIAQHHLGLDLHHV
FYQEGKSAGHRDHYAIDMEHALSELERHRRETGDNSTMGDGGDGGGSVNGTAGVNITQEA
AIERVDPAMLYQHKCNVFMDALDFLLTFTDEVEDRYMEAERFKRMTNESETQLMEARDPQ
KNIPEVNRTAFADDPAVNGLVLGYVDSVDMSALAANATDDESVQSGMQSEEDAMENWKQE
QNATEAGDYSDMLNALQATLNGTGQLDEFGCGDVPDCIIASMDHLTDLWNDVSLPEFAEL
SGQIERMSNYSKQLASGNLTLSEAYQQVTEIVDWVNATMMMDVWCGEVPVITEHPLPLAT
TFPGRSLELRCAATGVPEPSVYWYRETMQDDDELVGEGARLQLTDIEPADDGSYYCVAQN
HMHNATSNSSQVLVVAGASSELILRYTFASENYTQEVVETNATASFRIAALVEISTRLGV
EEDRLTQFEVLESGEVSHSIGDPAEEGDVSTDALVKRLTQLVRFGNMFVRFGGVRLYADA
QSMRRDYCRTACQVITENSIYGEPCVLPKLRCPYGPGSCRYSCEGDYIFQSGAAATCRRS
HEFSGFNGVPYCRRLNDPPFDVRFTGNASFPETTPPNTVLGQVRARDTDPTQTVTLSLVG
GGEYVELDGASGELVLKRAVDHEAMPAITVTVRATDDYVPPYYTDATFVLLVADVNEAPT
AIGVTGSLSVSEGTGYGAQFARLSTSDPDAGQSFTYTLSDDFGGRLAVLGSLLVSGSTPI
DFEETPGFNVTVTSTDSGVPPLSVQRRLELHVTDVNERPSASFECEAAVCGGLVEGLAAG
TQVGVVRVEDEDRGQTHRVVVRDDRSDGAIAFEGLRAVLAKNISDALPATLRVTFVVKDD
GSPSKTSEEVSIELTNLALTTTTTTTTTTTTTTTTTTTTTTTTTTTSGNNTVAATTTTTT
STTTTTTTTTTTTTTTTTTTTTTTTTTPGTTTTTTTTTTTTTTTANIAPAIDSLRPVVGE
NEPVGTEVAQVKLSAATEQSHEQYTFSIIDDAGGRFALANGDRIVTAQVLNFEESSSYTV
KIRVEDNGTPPLSSEREVVIRVLDSNDPPSLQLLATPATAASTIGSGSAKGTALYDIQIS
DEDLAQTHEVMFMGPHHDLVEERFGQVVLTEAIFRGENLTALDFTVRVRDTSGATADVAV
HLPIVYLGTTLEPTTTTEAQPELRSSAQSLGAGAITGIVLGVGVPLMVLLLCFVCMRRRT
QRRQLEHDLTLKKTAKSPFGFQHSRWYSMEQLNATSTTDDDDTYFDQPMSSPARERVVIE
EDDVDNLERGAGIGDLDYDDDEDLTRLNDAVGDELMFIDDGDDDGDGIRTAFEGSVSADD
AAFLQSLSQQ
Download sequence
Identical sequences PTSG_01807T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]