SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01815T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01815T0
Domain Number 1 Region: 2031-2127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000471
Family Cadherin 0.0045
Further Details:      
 
Domain Number 2 Region: 1761-1840
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 2131-2227
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000385
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 2247-2358
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000457
Family Cadherin 0.01
Further Details:      
 
Domain Number 5 Region: 2381-2477
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000957
Family Cadherin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_01815T0
Sequence length 2671
Comment | PTSG_01815 | Salpingoeca rosetta predicted protein (2672 aa)
Sequence
MRNAASMRVAVAALLMTVVITPITTVHAACQSSEPEQGDIICIQPSPFQGPNPTCSNGGT
LTATSYCQFENDPSRWAASNCECECPTRWSGTFCTEPGAICEGDYTCLRGFCESYRKCSC
PPEWTGDQCQLPVCGPGCDPVGGYCNTPGECSCKEHHTGQFCDVCEDGYYRSDDTGLCIP
KQTQGYCDRKDAAATYVPVTGVCDCSPFEWYGDRCDIECQKCPDGERQVGGCIGNEPVEC
GGCSPCEDGFSYRVSGCDGSTIDSICEPCNQCSPGTFANGGCINGEDTLCVECTECAEGT
FLSAGCDGIEDSVCGESCLPAATALRIPSAENAAQSVQTACSPLPHVPLNTTFDVQGTVT
ARFCNSTHESVCLGTVEIPALPAVYVQQETRLLHLRLGKRSPAPFTIRMSGVGLQVLQSG
RTNFNGESNFGDTMQTFDLQIDANAESVPFTITPHATGQQPVQFSYPDNVGATNYVDITE
ETRNLFGLIQIDEGSSVFVDFGVEEGEVPTGTHTLPVTILSDQVEFLAVDPWQSMGGNTH
QACSFVSLRLTSSVTLPISVRGLRVTTSPFSIVVPDESVCADGSLSVEQLQQLSTTSSLP
QTFMSAIEPSLPSWLRIAVDRDFSADVTVESDFFVKLIPGPEVTSIPNCNNLPVFSNSYY
AVVLWSKASVILVDGSSQSVPAQGQAFCIAVDVAAYPGDVVFMRVPKAAWSLLNALPFKQ
RLDSSGWIIGDTSVGFSRNSHLQGAPTIEFFDGEHIFKYNTGGLDFWLDTSLSKTLLELG
STSTLGLKVELSVDGVAGLSSDNTFTNMNQITAGAWEGYIEGEVNLDIKFSILKKTAQWN
FKARGAVVGSFDGDSGTEPAPRDNCGPLANPKGIFVTVTLSMRSSGFGNKILDSALGDFL
GFGAEEEFSLKYFILYKSSYVNGVWQEGMAGWGFRFDIGKICYFPGICARTLVDLQYSDS
DVLAPCDVFSDLYRQLPAGKVVSIRGTVVRPQIAGLFRLPGDASVRLVLSTTEFAYLSQT
KCTATLFGVSVETNFATGNYPQLFFRTNYQLRIFNIFKAELDVLALLPKFDSRTLLDWQS
MALHVRGVFLGDIIEAIATAVERLLRDWANKAVERFNKVKEVLDSIKEKLRQFEGIIDRL
QGALNSAKAIVEGAKDIVRGWQDAVNKAKKPLEDARERARYLRHRIDSICHIRRCPDICI
PGCEFRRRRRRVAMDSLELEEEIRHPTRSKQLLANHKQGHALLVRQRRWGSIRIPKLVCS
SCLWRIPNVPCLIANAICRVLKATLLFLLKVIDALISVLLLALEVVEKALDAALVFLDAA
NFLFDLAAQALDKARVVFRLIEVAIDAAKVAVDIVKEAVRGALELAATLVANSITYILSI
PHMEFELVVKGFTPREFSASMELVLFRSAHVRLSVYINFADIFRSIARVASDLFDRFFSS
FFRRRRYARGLGVDVVTVAHIAQHHLGLDLHHVFYQEGKSAGHRDHYAIDMEHALSELER
HRRETGDNSTMGDGGDGGGSVNGTAGVNITQEAAIERVDPAMLYQHKCNVFMDALDFLLT
FTDEVEDRYMEAERFKRMTNESETQLMEARDPQKNIPEVNRTAFADDPAVNGLVLGYVDS
VDMSALAANATDDESVQSGMQSEEDAMENWKQEQNATEAGDYSDMLNALQATLNGTGQLD
EFGCGDVPDCIIASMDHLTDLWNDVSLPEFAELSGQIERMSNYSKQLASGNLTLSEAYQQ
VTEIVDWVNATMMMDVWCGEVPVITEHPLPLATTFPGRSLELRCAATGVPEPSVYWYRET
MQDDDELVGEGARLQLTDIEPADDGSYYCVAQNHMHNATSNSSQVLVVAGASSELILRYT
FASENYTQEVVETNATASFRIAALVEISTRLGVEEDRLTQFEVLESGEVSHSIGDPAEEG
DVSTDALVKRLTQLVRFGNMFVRFGGVRLYADAQSMRRDYCRTACQVITENSIYGEPCVL
PKLRCPYGPGSCRYSCEGDYIFQSGAAATCRRSHEFSGFNGVPYCRRLNDPPFDVRFTGN
ASFPETTPPNTVLGQVRARDTDPTQTVTLSLVGGGEYVELDGASGELVLKRAVDHEAMPA
ITVTVRATDDYVPPYYTDATFVLLVADVNEAPTAIGVTGSLSVSEGTGYGAQFARLSTSD
PDAGQSFTYTLSDDFGGRLAVLGSLLVSGSTPIDFEETPGFNVTVTSTDSGVPPLSVQRR
LELHVTDVNERPSASFECEAAVCGGLVEGLAAGTQVGVVRVEDEDRGQTHRVVVRDDRSD
GAIAFEGLRAVLAKNISDALPATLRVTLVVKDDGSPSKTSEEVLNFEESSSYTVKIRVED
NGTPPLSSEREVVIRVLDSNDPPSLQLLRTVSGRTGKDDEISSGLPAGTALYEIVVDDED
LTQTSTVSFTGPSAALVKEEFNRVVLTRTLDAASTPVLSFDVVATDPLGATDSEHVELTV
VKLNQANTTLPSNRTRTTAAPLRESSTGTADPATIGASAGAAGLVLIVLLAYVIVLRRRR
RAADLQRMLDLKKNPVSPFGFAKNRWYSVDNLAEDKHAEAIEDTLMEARPMATLSKTQLP
DDVETDADGDEQWNGQAETNVDDVTALNELDGTGDLVFMDDDFDDDGPGVDEDDGGYLRV
GDDTELGEAGLRRNSSVRTNNLISELLSKRE
Download sequence
Identical sequences PTSG_01815T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]