SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01845T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01845T0
Domain Number 1 Region: 1265-1355
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-17
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 206-345
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000272
Family Polygalacturonase inhibiting protein PGIP 0.036
Further Details:      
 
Domain Number 3 Region: 1059-1127
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000958
Family SAM (sterile alpha motif) domain 0.041
Further Details:      
 
Weak hits

Sequence:  PTSG_01845T0
Domain Number - Region: 391-443
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0178
Family Complement control module/SCR domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01845T0
Sequence length 1415
Comment | PTSG_01845 | Salpingoeca rosetta predicted protein (1416 aa)
Sequence
MTLCAAACVPRTAAQAPCSFASSSETPLTILLRHNNAPVGASGQLYLPESPVTFSFSAPT
SNPGIAISADAVDTDDFLILNTTNLNEPIDNNAFERCAFNSVTYIVINGTTAALRTPPAA
AANATIKYLAFSDGAVSLERTVTYSCGCPTAQCAPCTACTISCPVEHVLVNQTCHNAIIP
DSACEPTPERAAMLDLRALSPVLTAAWDDVDHQCNWDGITCDTTQSVTGISLTSFAGTIS
LSMLPSSLANLQNLATLEAPSANLTAVSPVLAQLPALRVLNLASNPLGPGPLPAFVWSLP
LRQLGVPSTGLRGNLSATGQQVRLRATLDKIDVSGNFLTGPPPVAANASHTVQLTLQQSG
PYLFDCNGANATLDVGASADLTDITSTTCTLCGAPYALANLSPSVFPAPATADNEGVLFT
CAPGFLTSTTATAFNLTCQLDGSGLPGYYECSAPTPGECRCIEVVDVVLFRDITFTFSSS
HPPLSSFNTTLFVTTLAAAIGASPASIVLRIPPASTSDQTIAARVAVTTQTVSGFTTDPL
AAVDAALQDATALQTAFSAHAYFSALSGVTVEVVVTTSTTTLAPASTTTAPTTAAPNSDS
SSLPIPIIAGVAGGVAFLALLFLVICLISRRRRAKTNPDIVTMVDTGVLPGGSSTGSSTP
IQGRGDRQVMNPLFDDSTAAEGIDGSSTDGGGGGVALNQKRRMVLGNTMGASSDTGAQVL
QFDDLGDADVATETDDAAAKNAQQRASLVMEKVAGFGFDMGETSDGETFNLDDGGFGDDE
DVDVDAFDLDAIADAETQAAASATKTPPRKRRSSVGRGGGGASGDEDMEDLTGFGDKSLV
HSNPFITGLFPQQPTDVDDDDERLGAGENEATHGFADQSGAEVPPLPAKHEPHSAASVET
TSTVATTATTATPLQPPPQLPKEEEEEEEAGPPPPPPAKSHTPQDTVAPQPAATTTTAAA
PPPALPAKSTPAPAAKAKDSPYSSLPPRSKTASTSAMDGRASAASVSSVGSPKPGLSRNT
SASSRLSIKRSEEDRRAAREARINALKAAKEEAKRSQMRHPSQWSFNECVAWLRHHDFKE
FVDVFYNNGFEGKHLVALQARSFTGVRSVSQDRVLALIDAIARLKEVGYWVPPDIDDDDV
DTLAPLEEEEAPSGPPLPTTPAPPSTLPPSLATPAAPSSSTAAPPPPSSLPPSLAQMTPP
APPPTTTLPPRSGPLPPVPAPGPSAPDNGVVGSSGSAIGGGGVVGGAVDTSDAMETARID
YILSQHLTRDDAKALLKFGHGDEGEYLFRASQSSPGAVVLSMCHANTLHNFQIKRQGPLY
VTPNGLTFSSLPELVGHFKQHDNAGLPCRLSHACTHYDHLIPKPANDSFGFGDDVTYDDL
DSVQKQVPAEDEYEVLEATQTQRAQFAAMRASVQP
Download sequence
Identical sequences PTSG_01845T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]