SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01887T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01887T0
Domain Number 1 Region: 244-286
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000173
Family TNF receptor-like 0.003
Further Details:      
 
Weak hits

Sequence:  PTSG_01887T0
Domain Number - Region: 57-103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00458
Family Complement control module/SCR domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01887T0
Sequence length 453
Comment | PTSG_01887 | Salpingoeca rosetta hypothetical protein (454 aa)
Sequence
MMTTTTKARSSGAAVMMAATCVVLAIVGISLIPMSAATTVCDETTLEATFGRMPPFMAHN
CSSVEANAVCVVSCNATQHVAGASTTLTCHTTTHFLGQLPLCQEKRPRIEAMDASFRLAV
YDNDVVEVAYLTDDNTPNNKSGRLLTNVEIEDAIAEALSVDKITRPVTEIIAHNIENDGG
ISTIVQNMIDASSPTSDTLSDFLTATAAAVDEGDVSVLKVLRDEATALETRLSGDVTDAT
NAAARCLTTCPAGQYVSAWCTETQANQCSPCPDGFYNDGNNLDGSCKPCACSSGIVTQCR
KDSPPTCERAIQVLGWDNNGCGANQWYVDGNGDNPFGAGCWSSTTHSGTYLRADNGDKDN
FNVYARSRVKLVAGTYRFFCHVDDKCWIRYRKYGTNDGMTTIIDGGGQCCISREATVSLD
AGEYEMEFQAFEEVVGFLMEFYFDATFTPVPTV
Download sequence
Identical sequences F2TZ88
XP_004997868.1.12839 PTSG_01887T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]