SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01943T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01943T0
Domain Number 1 Region: 642-850
Classification Level Classification E-value
Superfamily vWA-like 3.97e-49
Family Integrin A (or I) domain 0.0003
Further Details:      
 
Domain Number 2 Region: 499-651
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.39e-26
Family Hedgehog (development protein), N-terminal signaling domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1066-1163
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-24
Family Cadherin 0.00077
Further Details:      
 
Domain Number 4 Region: 1476-1580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-21
Family Growth factor receptor domain 0.00091
Further Details:      
 
Domain Number 5 Region: 1793-1893
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.82e-20
Family Growth factor receptor domain 0.00063
Further Details:      
 
Domain Number 6 Region: 2054-2219
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.05e-18
Family Growth factor receptor domain 0.0012
Further Details:      
 
Domain Number 7 Region: 2675-2841
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.27e-16
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 8 Region: 977-1066
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000542
Family Cadherin 0.0026
Further Details:      
 
Domain Number 9 Region: 5988-6027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000171
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 2862-2899
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000769
Family TNF receptor-like 0.0056
Further Details:      
 
Weak hits

Sequence:  PTSG_01943T0
Domain Number - Region: 5590-5655
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000301
Family Type I dockerin domain 0.0031
Further Details:      
 
Domain Number - Region: 1355-1530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00675
Family Growth factor receptor domain 0.0025
Further Details:      
 
Domain Number - Region: 4568-4678
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00743
Family Cellulose-binding domain family III 0.043
Further Details:      
 
Domain Number - Region: 2263-2294
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0109
Family TNF receptor-like 0.0047
Further Details:      
 
Domain Number - Region: 2213-2248
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0147
Family TNF receptor-like 0.0025
Further Details:      
 
Domain Number - Region: 1180-1314
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0261
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number - Region: 3922-3962
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0267
Family TNF receptor-like 0.0098
Further Details:      
 
Domain Number - Region: 3336-3383
Classification Level Classification E-value
Superfamily TNF receptor-like 0.031
Family TNF receptor-like 0.0064
Further Details:      
 
Domain Number - Region: 3548-3592
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0314
Family TNF receptor-like 0.0061
Further Details:      
 
Domain Number - Region: 1621-1664
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0361
Family TNF receptor-like 0.015
Further Details:      
 
Domain Number - Region: 1740-1769
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0942
Family TNF receptor-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_01943T0
Sequence length 6681
Comment | PTSG_01943 | Salpingoeca rosetta epidermal growth factor (6682 aa)
Sequence
MMAGRAASVLALLLGVFVALVAVPATHARPQEGIIKPPMPSDTFLNISDAIANAANAFES
PISEGVVPFYAQPSEDSCAICEHILSRSNVAEALSPEAAANLADEACSAIERDTTRWQCR
GIAANYIDDLINGHCNTACADVKRERRSVCQSHVECLTTQFCGQNQECQACSVCAMEGVD
VALGGYCPCLGGTIEGITPAEGSTVVGGTLQTIEFKTENVGPAVNIELYKRGENTKAFRT
IQQFVRVSDTGVTKFTWPVSRYYPSGSYYITITSIASSQIVGLVPTNGYFQIQKSLACKA
HEVCSATTYCDIYSSCYYCDECERWQDAFDGQCPEKCYKSIATRAQVTFQLPKATSKIAT
NSYLPIVWNYNALVLDHIDLYLLPVNSFNSLLALSINQEVSAGSLAYKVPRDFPPGKYWI
VATHTADASLQVIGYTPDRANTIGDTGFEIFQEDCPSHDSCEDTEYCDADGSCYPCDDCF
RTGAAFDGTCPQKCGTGTVMEFGTSIPDGPEADASGVILEFILPQCPEFKALQHLTATET
VKPDPPTSNGDPSVMSKRLRRHITTLASVVRGVFGDDAYVRVLEAYVEPPADISKASLHN
VGRAARITIEGVPDDFASDRLGVLGGLAVEAGFDYVAYTSRDSLYVSVIADQCRQNLDLV
FLLDGSGSIESTALGGAPGTFQDRVLAFVSQVTTYFTIGEHDTRVAVATFASGATVNIRL
NDHFDGDALRDAIADIPYPQGQTYTSLGLRAVRQDILTEANGMRPASEGVPRVLVVLTDG
NSQPSYDPATEASILHDQNVNVFAIGVGSSISQSQLEDIASDPDARHVFNLRSFSLIGDI
VDAMSATTCDAPAVLTAGDSVSSVVRPCETLFFRPLCGQITNLNIELKSERGAAVMYVAF
NNQHPSPFDYDFAVTGTDELKRLTLNRSPDDTDPVYIAVQANVPAASADDEDAALAGVDF
VLTVYSDIFPGVADTVVQVAEDRPVGTVIFTPPATQLADPQPVFEFSLVGRTDEQFSIDA
TTGAVSIARPLDHELVSSYRLRISARAIGLPCLTGAIDIVVSVIDVNDNAPVFAQSLYQV
AVDEGRPRNTLVLQVQATDADSGANAMIVYSLATQNVPFAIDGASGVIVTTEVLNNDVQQ
EYQLAVVASDGVRSATAKVYVTVNPVPCPLGTASATGTLPCVACPDGTFQDGSAPVADTC
FPCGCGEGEYATGSCTPKHNYDCRSCPVYSYSEAGSIQLSDCECKDGYFKIEDEGTNTFF
CAPCTEQCPAGSYQTAACSPKHDIECAQCTSTCPSGHFLSGTCGGTSNYECTPCATCQAG
QFISSPCQVTGNRECSACTTYADCEQGTEYIDGLCTMGTDTSSPSCQPCIDTCAPGAFLT
GECGGADGTSRTRCQQCTVCTTSQYLVSDCTDDADRQCADCVTECDAGSYLVGECNPMST
DAPRCEPCTTEEDCEDNEYLDNGVCGGSSTPECQTCHPSCLACDGPGPESCTDCPSGTSL
HEGACLSECPLGTYSVDGECQACSSNCLTCNGTSDTCTSCDTAASLVLHDSECVSVCPDG
FFKDFAGGVCRRCKTCSGGTYKVGGCQGATNTQCEPWSAECVPGVSFESVTPTPSNDREC
TMCKTSCPAGEQLTGECITEDRTCVPCPSGTYKEAAGGQACVPCPTSCAQNEYLDGTCTV
TTSTVCRACTTECENDIYLSGTCNGTRSYPTCEECSTCGEDQYVLRACSSANGGSNTVCR
DCTQTCPEGHYMSSPCSANADAVCTPCTTADACLSTEVLIGTCGGTETTQCVPCHPECLT
CSGPSASNCTSCERGVFLSGTECRTECDLGFYPSTASGECELCHPSCRDCVGATSTACTS
CNSPLFLLGTECVAGCPTGYFGDTTSQTCRQCRQCPTGTYKTGGCDGTQDTVCTMWTPCA
VGEYEVVSPTAFRDRECAACRQSCPAGSELVGECGGPEGTSNPSCEPCDAGFFKEEPGAG
SCQACRTSCEAGSFLTGQCSTTTQPTCQLCKSSCGPDHYLTGVCEGRQDFTCEACNTCEE
GEYEVAPCLGSGQNRQCATCRTSCPAGQFLTGMCQGTTQPQCMSCRTQEDCAENEFVSGE
CGGADGRQNPTCESCDGSCARCDGSAPTDCVACSGSLSLDTDTGRCVSDCSAGTYAADNV
CEDCDPSCAACFGGASTECTACFPDTFLSNGRCVATCPQGTFANATTGRCQTCSQCPSGT
FVEAACTTTSNTVCTAWTECAPGTYQSTAPTTTSDRVCSTCTTTCPAGQELSVSCTPTHN
AQCTACNAGTYKPSSGPQACQACVQSCSEGYYVSGTCTATSTPTCILCTSTCAEGFFLQG
ECAGSSNPHCEACDTCDIGKYETRACTLNSDRQCSACTTPDACAQGEYLDGECTPTSNPR
CKPCTTTSQCGADQFLAGECAADAPNPTCTTCTTCAGDEYEAAPCTETSDRQCAKCTDAC
PNGHFLTGACPGSLAADFPRTVVVDGVTYAALDATFPEDTSTSCQAQASLPSGWSLVTNV
DVARDVAAQHPWGASCLVVSAEHAFATANSATLSPGDACHCDEQLGCMTSSSSGLLGVTA
CPRRILMQWAPPACQQCTSSCPDNHFLDGECGGRSNPVCRPCTVCEEGFYETVACTHLDV
GTQDRGTSNPVCTQCSPCAEGDSFEVSACSATADTQCQSCTTSSDCDLNQYLSQPCTLST
DGVCTRCTQVGDCDSGFYLDGVCTETQDASCQPCHPSCTECEDGTAQGCTACPETLALDR
IGFGNVGSCVSSCPPGQAEDVAANTCENCDSSCATCSAPGDATKCTSCTGVLFLTPSGTC
SSSCPAGMYGNATTNTCVSCTACDTSSSYESSPCGGTDNRVCSDLTMCPPGTHVIQQPTA
TSDRRCGDCGEGTYQPASNQAICIVWAECHPQEQYESVAPTSTSNRVCTDLTECTPGAEF
QLTAPTETSDRVCKALTTCKANQWQSMAPTATTDRQCTNLTVCAATEYQSMAPTDTSDRQ
CEPITQCQAHEYEKTAATPFSDAVCEAIRNCTQNEYQTQAPTATSNRACAPLTTCDFETQ
YISTPATPTSNRVCSALRSCFQHEFESQPPTTTTNRACTECAMCGSTQYERADCTANTNR
VCEDLTQCKASQFEAVLATLTSDRECSNCTVCGDNSYTVSPCSNVADTVCDGCTTCPMGS
FAAAACTATSDTDCQACATCDAGFFVSSPCTQGSNTQCTRCTTCQPDEYQQVACSASADA
LCQTITNCTQSQYQVSAPTATTNRVCSAVRECTAGQEYETQAPTATSNRACAPLTTCDFE
TQFESQAPTATSNRVCTPLSSCDAETQYETQAPTQTSDRECEGLATCVAGEFVATQPTPT
SNRVCASCPAGTTDHDSDSETACVACPAGHFSSAGSIGPCSLYMCPAGTADTDNSASTPC
EACDGTSSFQPAAGQAACLQATTCVAGEEEQDAPTAVSNRECRPCQLGVTYKAQPGQNTT
CAAVRTCLAGEEQTLAPTLSSNRVCTTCGPGTFKAAAGQAHGLASPPRTCAPGFQLGVTY
KAQPGQNTTCAAVRTCLAGEEQTLAPTLSSNRVCTTCGPGTFKAAAGQATSCIATQNCAP
GFQPTPRHEGIDNSSSCQFHVFQESVVPTPASDRQCEACPTGTFKSTTGQATCTAHATCD
TDTQYQTKAPTTSTNRECGPLTDCGTGEWEERAPTATSDRVCELCDSCEDEGLTQATACT
ETANTVCENCDTCSPGFFVSSPCTSVSQTECMECAECGADQYQTQECRVSTNTQCTPLTT
CTASQYETVAPTDTSDRECAALTTCVVGQYECVVPTETSNRQCCAIAQCDVGEEEAVAPT
ATSNRQCQNCTAGTTDDDANGATPCVQCPAGTFVPEGRTGDCSAYRCAPGTVDADQLPST
ACTPCSSGVSFAPTSGLTACVAVSDCPAGEEESVQPTLSSDRVCTVCAAGTFKEDAGQDD
CMTASTCASGTQYVAQPHTPTSNTVCANVTQCTATQYQTVAPTTMSDRQCRNLTVCEANE
YETRAPTATTDRQCATVRAACSMDEFESAAPTATSDRECTQLTTCRAQQYEARAPTPSTD
RECIYWTNCTAAQFQVTAPTSVSDRVCANLTVCTATQFEAVAPTTTTNRVCEACTDCPGG
THYEMTPCTASADATCAMCSTCSGDTYASAACSETDDTTCTACTQCVDGSTFESSPCLAH
DDRVCLPCTVCNVTEYIEQTCSATSDTQCLPYTTCDLDQFESQEPTRFQDRVCTQHTMCT
PDVQYEIVAPTATTDRQCDDLSTCTAQQYISTAHTATSDRVCSALRQCTSSEFELVAPTT
TSNRVCQRLTVCDPETEYESVPAGPARDRVCAPLTVCSPLEYESVAPTPTSNRQCEEQVL
PPLSPLAIFSASGGLALTSETTYAESTSAQTAVLLQGTTNGEEGTGPVFSASVGEASTSA
SLETTRPAPAAVRFELAAAGTIYEDDPWVRGVLQVSTPANVVPRATAMDVTVRLDAENAT
SVSCTTNAHGLCSFALRVPRGWYTPGVDATANVTFAFQEAALQGAVAVQGQSSRLVTLAS
SAVFVPDNDVYVRLPNRDVRAGETLELEVLSRTAFPIASFAAVVTTSDDSRLRVNSLGLD
FASWTGTSKAPSTTSAAVLGIASASARLSGPAGGDQLLFTISVSVPASATPGQASIDIIL
HSLDNAKGEGIRPGDRALPARVVFVDRQGADATNQGVVTVSGAQSQSIFAAPVSTLLAYT
PTISGVAALHHVELFTMRESGGLEALDAADVTCSSSHPAVVDVTPTCHLKLGASSDLNAY
AATITVTLDADAGVTTAFDVRVLRPALPVQLTVDDAELNAVTGWLDESSNCRQLYQKTRV
RAFTSFSDDSGLVVDNIDVTKYVTMHVSNDGVATLSTPTHAGHDFAGVYVQGFQPGTVQV
STTVQGLASSVSVVVSSTPVVATRLDITPVVSLGFSPALPSELASQAALAATLQVSSTFT
ATNQHAPVGASVVLSDATRLELTAADGVRLVSDDAEVIEVQGLALVVRSQVQTASVPVLD
ASWSSGACAAQPIISRAVPVSLSLPTVASIAASTERTVLAAPDSAAAAAPFMHASSTPVL
LTATLTGGARLDLDETDSLDIVSPSELAVTETSTGLLVTVASGAAPGVYHAMVTYETAST
NISISVVDVAALHVTCRLHANGHTSQAEAGVVASLAPFQGLSPATFQACAVDVRGVLSTD
GGATAVQTTDDVAASATISAVSGALAVTGTIVSVASPTSPVLGQAAVDVSVVGVTTQLTL
TVSSTPVSVASATLTFPSQLRGLAQTTSVTPEAAVTFSDSSVFDSAAVLPAGLVEFMLEE
PAPLGATGASASLLSAATGEVRLLGNSVERLSLFLVTVDATSPVVLAEASFACNLLPAEG
EVDFGVNSGLALSGATAGSLLSFEVRANAGSADIDRLVFDVLFNASLVDFVTAGAGSDFV
GAVNAFSSTLPQEEQAAFATHFVRVTAEPNAGVSGVPHIATITFTVKADTADEQVFFAGR
VAAFTSRAGGAIAVGASESTPIVSPAASISTVIEAPSVMNRRRRRRRRDVATTACPTPPC
AVCPNGDTHQTGDVNADCVFTLDDVTFFMDAYLETLLDPNYFSTLLPVQQEQLDADQDGT
IGVLDVDLLSRVLSKDVRFVRDVMVQPVDTSNGCRLEVAVRVFGAGNVPALPGSTHVFFD
VESMSAGFDTLFDASVVEVGQRINVDKGSSSLQGGLWQAAHLGGDVYGVVVRTPIASEDM
HGITVFQLTSVNTTSGSGGFVGVSTDALSFTWSGPRVPPFNFAGYDFELTVPTMPPFQFV
RTAGYNPFATFTNEQATASCHATTSCTASEYETAAPTATSSAECMPISTCDAEEYETEAP
TATTDRECVNRTVCNVPVEYQSSAGNATADRTCTNVTVCLEGEIALLEPTPTSDRVCRLD
APCDYNMYESVPLTLTTDRVCLPVSECDPGFEETAAPTATSDRECSLIDYCANDPCQNNA
TCVSSTQLLTFVCNCPPGFTGTMCEYADACGLLGDQNPCAPGSQCVNDAGGIRCECALGQ
ACGCCDGFTFLSCSLQTLPDTGSYCSDPATVAEDLDNLQSRQQQQSSATGESLGIIVGGV
LGGLALLVLAVLAVTSLRRRSRDKSEALVKYEQDPFSGMLTSMRNPVFAPASQYLAAFKR
VVCFSFLRYNKDLVLTEPAEELGTVYDILMVPRPPKRTLPTLKDDTNMFMEAKVSENERS
LDEVVDFLSLALADLVMEEAIDTAAKEQSNGTRPYRANVPNDASGLIPKRWAAYLDPITG
QVEEPAYEDASLLRGEFEDDEFAVDGSVSPLTFAQAERFLARRVTMRKSQMQRGGARDNA
FVYDMGAFSGDDDNDETYSTANMGDEPERMYDVGSSDGFGEPVYDEGDGEGGVQDTYAFA
SNPAALDDLEDFADEEATYDMADADTQNAVRRGKSKKEIEAMYSRANKASVREPNYDNAA
PGMPGEHDDDDYDSANNLGLSDEEEDGGPDYDNTLPSGTYDVRTMLTSGLNDDGDDDGAE
PQYLGGNGSRRRGSEPEPVYDQGDGDVLGALPSFDEPDYDLGNEAPGAEESGERDPAYDM
ATAEGDSAGDTTGLMNTDPDYDIGDAPAQEEEGLVSELFDDEEEHEPTYAFSQPRNTSVR
PRALRSLHGRTRPESLDGSSI
Download sequence
Identical sequences PTSG_01943T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]