SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01972T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01972T0
Domain Number 1 Region: 1380-1501
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000000136
Family Cellulose-binding domain family III 0.014
Further Details:      
 
Domain Number 2 Region: 351-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000968
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  PTSG_01972T0
Domain Number - Region: 1556-1622
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00129
Family Type I dockerin domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01972T0
Sequence length 2271
Comment | PTSG_01972 | Salpingoeca rosetta hypothetical protein (2272 aa)
Sequence
MATSVLAVLLAVLALLSGGALPRTCFAAAPCTPAPCVTYDASGTLIGGESTLTIEWNVEA
GLPNIFIVLGSLDQDGGTVQRFLSGEVVLNHTLASPATTGSYNWDIPYIAEDNLQILLQI
APDNTRASSFVSGDTFSTEFPPFAVTSPRAYSFLIPGEDVTIKWQNFDGNDVKIQLVFRT
SEGDLAYPYSLFGDESTPNSGSATYTVPSIANNYPQPLLYTHNIYVKEVDGGTDDFFLGP
LFVPAVGYSFAGSVGTTGRAVQGTNITVAYTIVNFADEEVAVAVSNAMSGEHIIGAVQNG
FTFDESPASTPYSAAVGILLNRRAPTGTVTVRLYVERVPAISASRQITVLPPCEPGTFYN
DTDVTCNACPPDTFTDTINQDACQPHSTCPDGWVVAAAGTSTADTLCVDPAITLPIRMAA
AAPPGLLVAASPSDTTSVSDNTTVTSRSLLTVAARDSPVSIHSALGDKQATASITGTAIT
TTAPTATRVRAVLLGEPGLSHSRQPSQPAVVLPHDAAVKVLLFALDGRGLAMQDAECHVR
IEDNAQQLTAVTAMCTTSSSSPTPSCTATLTLPSSYFTAVARDHADRRSWQLRVTSLDAN
TLQVQSVTGGSGWTVTASSLPSRDVAVLGVRAIEQGGGGGSAGAEESALFTADVLVGAMA
ARDVVLNVSVVEAFDSSGQPVLSGTAPLVVASSNPNPTAHRTSTVSLTTYNEADVVALHA
FPSMRTAGAPPTTAPLSNVLLNTAALNPDNAALQHPLTVSAYSASGSGTTLSPSTSLVCS
SSAPEALQVDASCGYVHFTGAETAGSDSAQVVVQHATLPLNTTLGYKVWHPAAFRIAIDV
QGSSSGSDVVLRRIGGTALYQHVGYTIEADWSSPTTMTSGGADDWLNSTDVTEEVWPLLR
GQHVGGGSDDGNVIVTPLSITTNTSGTFRLCISHPLRTPSCLGARDVEATDNEPATPVAI
SATVVASVTAATTTSSADTYTRVSSSFTSVLTADQQSASVVVHAIFSDGSTRVLDPALHN
TTVTTGSPALIASNINDASSNSYPFVTTLGGGSVAVGLTWYVSDTTTVHGTVDVVNALPA
VTGVRVAGLPAAMAPSTDVSSQLPANLASSTLVSVFLQYDDGTEIDFTTDARTNIATEGN
ITATVDGTRLRVAVADGSTEGQARLLVSFEHTGVTASLAVEVVVATGLRVALRPFPAFPG
SEDEEVAEMRRLGASNTWQQAMVDVSAVLSSREVVSANDHAELMVSTPAFFNYNSNTRLV
SPTPQLPGDEGMAVQMRASVVMENGLTLTTTYLFPNGGALALPNLITFDITTPTATDAVV
IDSATGTATLTGNSRTQETLAVYAGDNADVNATALFYVNLVPTNYDVDLGATQQLPLAPV
TGGDTVAISVRVRLPSTLAFASISLQVTFDDAVLEFVDVAEGSDWPGGEFAGGLDGSGRI
SFGGSTAGVGPGTLTLFEVTLRVKGGAGAGFSSVSGTAVTIADGDGTLLASDVPFVAGDV
TLEITAPARRRRSHQSASATRTTGVRTFGFSSTTASRARRAECGSPPCAVCADQRQIGDA
DGNCLFDVRDVTFLKRFLNERLLDPDGAFVSAVQAFQMPDMDADGNTIINTVDVNFLLRA
NFGLFALVRSVNMTAPDTDPSLAVSVEQTECSVAVYVQTISGGDGREQVPSDPQRTAVFV
YLDSPNVTLHNNAQLVVTDGEVVVADAATNQRGVFIKAAHDPPRDAFFVAASSELPPDLV
LTGVPLLISIDAAGETNADRATAALTYSDAPVSIAGEQRVAFTFLGQGFELVLNDYGPRV
WVSTTTVSRNCREQLMCDDEAGEYVAVNATTTDNPVCRALTTCVLCDSYETRAPTQFSDR
MCANTTVCTPGLEYISVLPTLVSDRRCSNISAPCASTQFEATAPTNTSDRVCTNTTVCDL
STQYIVTDATLSSNRVCANISDACVFPLQFETQAPTNTSDRACVTTLVCTASQYETVAPT
PTSNRECTDLHTCNLDEYAIVPPTPTTNRVCELATVCDDTEFESVELTPTSDRQCMLNPC
NVSTICFPEGTCIPTATGPYCDCPPGIDCATARGQSTKRLLPTSSTTTTRTITIKTDSSG
SPTAVPIAVIVGGAVGGVVMLIIVVVVIVRRRCRSKRRVAVGKEGAQAYAENPMPVTVRS
SGEGDYDVVEAVYPNVNMRETRVGLGGRRPGRRHSTTSDGSDVRGEVHRLHQWNATVYDV
GHQESDGGRMHAHDWDAGDYDMKDLPVLPASEYEQVDVGKRQRSMSTTSAC
Download sequence
Identical sequences PTSG_01972T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]