SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01973T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01973T0
Domain Number 1 Region: 143-278
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 257-375
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 58-155
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000914
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 474-572
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01973T0
Sequence length 1024
Comment | PTSG_01973 | Salpingoeca rosetta protocadherin gamma B6 (1025 aa)
Sequence
MARPLGRALARSPRRRHPSPACTGMLVTAGLLLASLLLGVAVAQNTPPTFQGTPFIELYI
FNVPETNDPTSTVGTVTATDPDAGQTLQYTLSGSGSAAFKIDRNTGVVTSRLPLDADFGT
TTYDDITVSVSDGVDSTTGRILIAITDVNDNSPVFNQDLYTMKVAEDLEADVTFASVEAV
DVDVSTQNSRVTYFIIGGDPDGIFQIATVSGEGRVSVATQLDYERNRTHTLVIEARDGGT
PTRTGNTTLFIEVTDVNDNVPVFSQSLYEVNLPETLRERPARRRRAVGTVLVTISATDDD
TGDNAEVRYSITGGNELGLFALDEVTGDFTLEKPVDFEELTNPVLDITVVATDLGGAVSD
PATIRVTVQDRDDLPVFESDQLPELTIFAGDIGPVGFAPVVDDSRKNTFECRLTTPGTPF
TVAAATSGATGCNIVAQSSTTELGGQMFTLMLEIADQVGVLSRTRVVVNVLPTNRDPPEF
AMDIFDVLLSVATQIDTTVVDLGVTDPDGDAVSCKLLSSPKGLFRIDDCQLVLDSRLPTD
GPTFFDLLVEASDAPTRGNRNLTSTAHVQITLTGVCPSDDASCTCADEGATPPNCTPDLC
EAFPCVNDGVCSQGVSNQGLPERKCMCANFFGGDDWRGGRPTTTTTTTTTTTTTTTTTSP
LATVTFTVPDDDEINDCSQCQNGGTCVRTPTGQVTCDCPRVQQGRFELCYENADCTSQLP
CDQVPFPRGDATGSSTSTPATRPELTCECPRVRQGGVERCYEDARCTNLSPCDEVPFPRG
DASVSTTAAATVTFTVPDQFTVSDCTLCQNGGVCAFTASGQQFCQCPRVPIGSTDFCYEN
FDCTSLQPCDQVDGPNGDRSASTNSTTAVPIAVIVGGAVGGVVMLIIVVVVIVRWRCRSK
RRVAVVKEGPQAYAENPIPVTVRSSGEGDYDVVEAVYPNVNMRETHVGLGGRRPGRRHST
MSDGSDVRGLHQWNATVYDVGHQESDGGRMHAHDWDAGDYDIKNSSPPYETVGKRQQSTP
ASAC
Download sequence
Identical sequences F2TZH8
XP_004997958.1.12839 PTSG_01973T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]