SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01974T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01974T0
Domain Number 1 Region: 1467-1725
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-71
Family Protein kinases, catalytic subunit 0.00000297
Further Details:      
 
Domain Number 2 Region: 1968-2046
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.07e-19
Family Cap-Gly domain 0.001
Further Details:      
 
Weak hits

Sequence:  PTSG_01974T0
Domain Number - Region: 354-433
Classification Level Classification E-value
Superfamily Cadherin-like 0.0286
Family Cadherin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01974T0
Sequence length 2048
Comment | PTSG_01974 | Salpingoeca rosetta eph receptor (2049 aa)
Sequence
MSVSQLRFRRIAAIRARDANAVPFAARFAWHGPTDEVWLNFNDTDSDECEEGKSQDLSGQ
YSCKDGEVFCLDTGYGESVPVTPTSDRLCTQCQPGTYQDKPGQTNCISQPSCDPGTYILR
EDVSFKRECRACNGVTEYQDESNQYECKRVTVCTSSEYEVEPPTAELDRRCRSCELGITF
LDAALQQCQPVTECAPGTVESEEPTLVSDRECRAETFACTDGQQDGDGPTCACSVDHCHT
CTKQPLSEDKYGAILLQVNRHPQLSTLVRPCQQLGPQDDYVAGCVTECRNETDCTAFFVG
VSGAEEGICCLYSSFSAIGSYNRPGGSFYALSQCDVCDDGYFKSGIGCRKLSVPPSVGQA
EQAITLPLTATLGTEVARVNATVEAGYGPLSFTPTRPSEVFAVNASTGVVTLMQPLAVAS
AISITIAVADAREECFALNEAGTDVTITAGGCVSHTTLNIQIAVFIDCPKDESYYLAPEL
DALEVSWTPPRLPSFLSLDVHNNTPAPPVSFGEGIHTVEYIAGPLDVGGNLQCVFDVALR
YGFSILVESIGHATSGPLLQDFLLADANLVDGGARPRGFSGDIISRPLAIGLQSKPGLPF
TIFTRNSVQGRVVVQLQWCTSGSVPSDPAAFVNGTTTVKLLQPSDPLLSASLVFTDRGSG
VTDDGRCFRIAAESSPVAGTLSFSGVDIAFTYTGPARARRSPSSPSVTIRDYAPREPNFV
VVQFGTEDGSPLDDNSGPFLSQEDTIAPRWLNCPTAPVVAHALPGEATAVADWEELVAVD
NVQVVETHATHMPGDSFSVVQSPHTVTYTASDGTLSTECTFQVEVTFDPITADVVATSDA
VFSVSHQVLPLLHTQTFTHHLIGGPNDTSLASFTLDAAFVTAIRFTVLPPPGEHFFVRTV
AGAERGQLEVDFVFSVAGASVALDSLAFDDDAVVAYELGQFALDTTPAADGLDADELQDS
LAPKGTIDHAHVLVDGSAGVIVVRGTATDTFRRGFSFGTMSLQVSFPLGRNFTSLAQALT
GSGGGGGGSAAATTPAMALGTNTTTTTTTTPTVPTMTASMPMTTAANSSNTTATGGVASS
ATTAVPSTSTATAAAETLPFLMQSGSFLGFKVFLPANDPDDPRGFLSLLDTQAPFFRRCP
FSLHRDIDVVLATVPREPHAIANWTLPVVDDNRGRDQLTLTSNVPAGGVFALQAPGDAPY
AVQYTVADLFGNTATCDFFVAVRDFEAPRVLVVDDVVVTLPSAPYSPGHAVLATVTPEQV
RAATNTTDNSGAFTWTAPATALALGTGETDVMVEAEDEWGNKGSAVVRVRVLDTTPPTLF
CNDPSPVVTPGVQAEAAAVNFTAPSYVDNVPTAATLTYSHAPGSLFPVGTTHVNVTATDA
SGNAALCVLAVEVIPFQAATAPDNTNIVAGASGGGAFLLVLLAVFAALYYRQRKRMRRPQ
NWDEIFEMIEQFKGRKDGSDGPVVPRELNRANIKLLEELGKGAFGIVYKGLLTEAPIPGY
LVACKSLHAKATASERIELMEEAAVVAQFDHPNVLQLIGVVSVGKPVLVVLEFMEYGSLR
SYVQDNDVDEATRLLFAGDCAEGLNHVHSKGFVHRDIAARNILVSSERRCKVADFGLARD
TEESDYYRSRGGQLPVRWSAPEALEDRKFTRATDVWSFGILCHEIWTRGKMPYDGWGNQK
VWVMVCDGYRLPKAETCRDVVYEQLLACWHAEAERRPSLADLAAFFRDEYEAYTGESLQP
KDEYLAIGDTPHSGTKKPRRSLSGTLGTLLSGFRRRSSQAGMVHNPVYQDVEMSQLVEVA
EEDGDGSCRRNQDPHQLYDMGDGGDADAAGNISIDSDDDGRDDGDEARQLYDLGDVDEGV
GQTALTTNAASSRSGSTSTSDRDSVDDMPQGFGDTFEEPVTQQVTPTKRKHRGTSVVDEH
PFGFSDSSANEDNLHSDDDLLLYGNVDTHHRQRDGDSGGDATAATNTTAPIAASDVGRRV
RVQGYECLGTIAFVGKHATKGTDRVGVILDLPRGLNNGTVGGVQYFSCEHNKGILCVPAK
VSLMDDCS
Download sequence
Identical sequences PTSG_01974T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]