SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01986T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01986T0
Domain Number 1 Region: 204-269,366-495
Classification Level Classification E-value
Superfamily vWA-like 6.44e-40
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 2 Region: 714-832
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 614-734
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000542
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 49-191
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.0000000000133
Family Hedgehog (development protein), N-terminal signaling domain 0.0029
Further Details:      
 
Domain Number 5 Region: 931-1029
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000343
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 1095-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000276
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 1055-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000936
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01986T0
Sequence length 1763
Comment | PTSG_01986 | Salpingoeca rosetta NOTCH2 (1764 aa)
Sequence
MAYLRVCLALVVALAVANATTVLHSADVEAPSIINTRSLERNARALDALEPGEARPEFAI
SPEVVVGPVRQLIYPGTPEFDQFLPPNDNEDIFFVQEIARHMSPRMAQVLDILAQTVKQL
KLSDGTPLRLAVRNGYEDPTGSETSPELFHEGRMVDLALYNTGNGDIINNAADMGTLAAL
AWRDRLDWVRHFQITPQNAAQFSFVRVAVVPESCGATLDFAFLLDGSGSLLQSGWDSQIQ
FVKDVTAYFDVGRNRTHVGIVTFHGPRVSHLSYNESIPDCPLGTVWEPDGEGCICEVEGS
QCTGSACGTGYYELEAGGCQGATDQNIDTLPDCEIRQFFPHGCADCTCNPLGQKYQPSDS
YTVDQLFSMTQDHDDLAATLDSLVFPDGATHMSAGLEQIRDTIFQLRNGMREYEQAIPRV
LIVLTDGKSNPGFEPHEVAEQLRNRGIIIYAIGVGDYYLPELEAMASEPMDRHVYELADP
SSLFTIVDRLSFDTCDIPGLLRAGARIALSLSANEFRYFTIECNDNPDALTDKVIVELID
SPDGSRTHLFVSSRTPNPTSLNHAQSLGPLPPAKVLVHDRTFSDGSSGLVHVAVQAAAGK
DVSNAQLVVYQLLFTDFRPIVSVPEDTSPGTEVVPPAQLIDSIDAGITFRYSLEDPYGTF
AINPADGSITLAGPLNREALDTYVVRRWVVDSPPVADQCLRSFQFVTISVSDVNDNVPVF
SQSLYEVNLPETLRERPARRRRAVGTVLVTISATDDDTGDNAEVRYSITGGNELGLFALD
EVTGDFTLEKPVDFEELTNPVLDITVVATDLGGAVSDPATIRVTVQDRDDLPVFESDQLP
ELTIFAGDIGPVGFAPVVDDSRKNTFECRLTTPGTPFTVAAATSGATGCNIVAQSSTTEL
GGQMFTLMLEIADQVGVLSRTRVVVNVLPTNRDPPEFAMDIFDVLLSVATQIDTTVVDLG
VTDPDGDAVSCKLLSSPKGLFRIDDCQLVLDSRLPTDGPTFFDLLVEASDAPTRGNRNLT
STAHVQITLTGVCPSDDASCTCADEGATPPNCTPDLCEAFPCVNDGVCSQGVSNQGLPER
KCMCADFFGGDDCEVTPCDDTPCMNGGTCNPTPNVGPGFSCDCPVTHDGDMCENETGITT
TTTTTTTTTTTTTLNPCDGSPCSEGQFCRRVDDTNFECVDGSTTTTTTTTTTTLSTTTAA
TTTTTTTTTTTTTTTTTSPLATVTFTVPDDDEINDCSQCQNGGTCVRTPTGQVTCDCPRV
QQGRFELCYENADCTSQLPCDQVPFPRGDATGSSTSTPATRPEVPYTVPDSDVIDDCSQC
ENGGTCVVTSSGQLTCECPRVRQGGVERCYEDARCTNLSPCDEVPFPRGDASVSTTAAAT
VTFTVPDQFTVSDCTLCQNGGVCAFTASGQQFCQCPRVPIGSTDFCYENFDCTSLQPCDQ
VDGPNGDRSASTNSANNSASTGIIVGAVIGGLLFIILVLFLLSFCCNIALCACLGGAACC
AGGGTPTAPMYETADNKAASFDNPTFVSHYAATGTGGAGVNGPNALSNPFYAMGATGNKG
TGQYDSVNGQYDSIQEPTYDSVNDGHASLRSNNRMQVEQGRIRLASVARHNPLTAESSTD
AAASLDNPMYQVGQQNGSSPMYAPVDGQPSSMSNPTYERAQGQAPSNVTYAAPTASAESD
MYFDVDARNEAEEAYTQHRIAATGDASYIDVLPRSGAAQNAAMPSSMSNPSYAQAGNSMP
QYDNPTQGEPAYDTVPIDHDATA
Download sequence
Identical sequences F2TZJ3
XP_004997973.1.12839 PTSG_01986T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]