SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01998T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01998T0
Domain Number 1 Region: 53-152
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-28
Family C-type lectin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_01998T0
Sequence length 158
Comment | PTSG_01998 | Salpingoeca rosetta C-type lectin (159 aa)
Sequence
MTARHTASIRAPLLLLLLLLVLPYLVRSAADPARAQAILSRRPRNTYDCATLEQMGWERF
GDSVYAFFKDHNRPFYRSLNNCVQGFGASLPSVHSREEMQFITNLTVGSTNPIWLGAQRI
NNTWTWIDGTPWDYENWIPTEPNNENGNENCLRAGHIS
Download sequence
Identical sequences F2TZK6
XP_004997986.1.12839 PTSG_01998T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]