SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02041T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02041T0
Domain Number 1 Region: 527-843
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.05e-58
Family beta-N-acetylhexosaminidase catalytic domain 0.0069
Further Details:      
 
Domain Number 2 Region: 17-194
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-24
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 368-480,513-525
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 0.0000000000419
Family beta-N-acetylhexosaminidase domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_02041T0
Sequence length 1044
Comment | PTSG_02041 | Salpingoeca rosetta predicted protein (1045 aa)
Sequence
MSGSSAEQEEVRQQLTLALEQGRADALRHVLDHQAQIAGGADGVRHLLTSTPMQEGNETM
SPLHYAMRMGHADAARMLVAAGADLSAVDSEGRTPVDLAKQGHVPDVLTSELFTAVARDD
VERVTQLLSAGLTLDGVDNAEKWVFRHLAKGADVNARNACGATPLHDAAKRGDFDVVQML
LAAGATRDPVGVGGAYAQRRPVDMITPTAPNAAQLAAILHPDAGLASAMAGEEAANSNAT
TADANERATQQQQQQQQQPQEQQQQEQHQNHEQGGEGVSPPTSSSSSSWFPGLDRFVQLA
ADSMEQEERERMQQELLQKQQEQLSNLQVSDERDGTAVADDTSAASSEHSSERIDPILPQ
LSHPLQLLWPQPRQITQFRGRPFVPTPSLEIYFAPFDSAHAADIDSIFDYLTSGLKALGH
TTTRTHYPTLKCDVTCRITAALARRPEAYRVVVDSSGVILNAGDVSGLRHACTTLLQLLR
LCCWRPVDMNTDADATPTKSTPADPSTGNDREHRGIPPLRIHDFPDFPNRGFMLDVSRDK
VPTMATLYALVDLMASLKMNQLQLYMEHTFAYAEHRIVWEGADPYTPSDICALDRYCRQR
GIALVPNQNSLGHFHRFLKHDRYRHLAECPEGINFGPRPSGPMDAPFSLSPIDLRSISLI
SSLYSELFPNFTSSSLAHVGLDETVDIGQGVSHDDCARDGPGAVYLAYLQEVRKTCLKHN
RTMMFWADMLHDYESAVMFSLPSDVIAMEWGYEELHPFEERCELMADAGVSFYVCPGTSS
WNSLTGRVSNCIANIRNACEAALKHEGLGVLLTDWGDFGHTQPLCLSYPGIVTGAGFSWR
VDSKACIPRDEQQRLAEDWRGEWGEEDLAVLIDHHVFHDEVGGLGHVLTSLGNLYLHAAA
PARLNRNGTFLFRFLNFHGPDTNIWDRLNLDGLKSCTRELRMQMRLIEALADRRDLNEEA
QTTVRELGLVSEFALFACRLAMLQTRAQAPIASLELTHRTDLANRLIPLLTKYKEVWMLR
NREGGFKDSVGRLNHTLDCLLRKK
Download sequence
Identical sequences PTSG_02041T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]