SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02061T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02061T0
Domain Number 1 Region: 467-512
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000024
Family TNF receptor-like 0.017
Further Details:      
 
Weak hits

Sequence:  PTSG_02061T0
Domain Number - Region: 123-174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0146
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Domain Number - Region: 164-228
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0149
Family Complement control module/SCR domain 0.0062
Further Details:      
 
Domain Number - Region: 332-427
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0314
Family Apolipoprotein A-I 0.025
Further Details:      
 
Domain Number - Region: 516-558
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0383
Family TNF receptor-like 0.025
Further Details:      
 
Domain Number - Region: 56-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0435
Family Complement control module/SCR domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02061T0
Sequence length 710
Comment | PTSG_02061 | Salpingoeca rosetta predicted protein (711 aa)
Sequence
MAAVGVGMALMAAIAVLTLAVGSRTCAASSASAAGAPPASCNSTTLRATFGPLPPFLTFT
SCEDVDANATCTVGCDGTQRYTGTAATLRCENNGTAFFSGQLPICHPPCVSSSEDVDDSV
AAKCSEVAVGDSCVWECTRGYQGDSVLRVCVAANHTASSFTGQLPTCDPVPCFLSVDMQG
EAYNLADCAIGQHHGDICTASCATGYAGQATTFICDDGSFVGRMPSCTLKRPRMTTDAGS
VLLGVYDEQAVNIAYFTDDNTPNAKSGRVLTEREIEDKIASAFEVDRDNNPVEDAIVQDI
DSSGGVRDAVQRVIDANSPTGATLTNYLQSTEQSLGNKIMEETDAVETTLRSELAGKAMS
LETQMDNALNAVANNMEELQRQVRLDFVEAAHNTSQRVWSAATSLETQFNAAITNVQAEV
TQVSNHVGAKVPSLEQGLQGLAADIGGVDSRVAAVSNAATAISDQVNRCLRTCPAGQYVS
SWCTSTSPNACSPCPADTFSRGTGLDTTCAPCPLTTCPAGTYAQSCNAATGASLGCATCP
SNTYQDEDQHVLRQCKPCSCPSGWQPLGSCVRDQPFKCVQNYISVFDGACGANAWLLTGK
AGGCYTSSTHSGTYVSSGDIGGDDFDVYATARVRFAAGRYRFFCSADDCCWISLRGPTNV
SPINPSSCNGCTSCSGHTAYANLAAGEYTVMYRAHERGGGFGMTFYIDRA
Download sequence
Identical sequences F2TZS1
PTSG_02061T0 XP_004998051.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]