SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02067T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02067T0
Domain Number 1 Region: 149-236,274-515
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.34e-87
Family beta-N-acetylhexosaminidase catalytic domain 0.0000000378
Further Details:      
 
Domain Number 2 Region: 29-148
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 1.44e-25
Family beta-N-acetylhexosaminidase domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02067T0
Sequence length 537
Comment | PTSG_02067 | Salpingoeca rosetta beta-hexosaminidase beta-subunit (538 aa)
Sequence
MMNGRASVAFSVVVVAAVCWLAGAHAATVWPQPLQMATTRDVYHLDVSFFFNSSSTSDIF
LAAARRYETLMTPFMVSNGDFTMCQVNIASKNESLTLDTNESYSLSVSSSGVIINAETVF
GAMHGMETLSQLVTRDGVNGTEVNDSPRFRYRATMIDTSRHWYPVVVIKAHLDAMAYAKM
NVLHWHIVDDVSFPYESLTYPKMSKSGAFSPSHVYTQADIKELLEYYLAPVKLRLSQEFS
TRLGLSLLSSSSSSSSSSSSSAGYNTVSDLVTQCYNKKGEPAGTGPLNPTLDSTYDFLTK
FFAEIKNVFPDKFVHVGGDEVGFGCWESNPQVSKWVKNHPNISTYAELEQYYELNLLNIL
GQQGSSYICWQEIFDNGIKILPDTVVEVWKGNGWNDTMARVTKAGYHSVLSAPFYLNYIS
YGQDWVNYYKVEPTDFDAPEADKDRLVGGIEACMWSEYVDATNFIARFWPRAAAVAERAW
SAKNVTDVSSAGPRLHEFRCKLNARGINAEPAMDGAINGGDYSYCDSEFVPVYQPPF
Download sequence
Identical sequences PTSG_02067T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]