SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02082T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02082T0
Domain Number 1 Region: 324-699
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.48e-71
Family Amylase, catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 818-906
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000000000189
Family Starch-binding domain 0.004
Further Details:      
 
Domain Number 3 Region: 209-305
Classification Level Classification E-value
Superfamily E set domains 0.00000000000021
Family E-set domains of sugar-utilizing enzymes 0.0088
Further Details:      
 
Domain Number 4 Region: 714-815
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000414
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 
Weak hits

Sequence:  PTSG_02082T0
Domain Number - Region: 30-63
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000196
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02082T0
Sequence length 915
Comment | PTSG_02082 | Salpingoeca rosetta conserved hypothetical protein (916 aa)
Sequence
MSEPKRGDEEAREAQPPLTTEAGRTHTGTGTSGVPRMPGDWVCDQCGALNTEQQFPCTQC
RYPLFELEDAHRQEAGVFEGRHSSVSVEPNAQNPHAGSRGRPRDAGPPQREPTTPIERTF
AQLSVEEKEGLAAPVPHLNWQCPVCYVIGAEAPCVCCGYDPDTTELPVLAAAEAQEEAEE
EERSLYEQQLAAGTKIVEVTHGAQAGPIPLRSGGFRFRVWAPNAQRVFVMGDFNSWKERD
QACEMRKETNLTHWRIDIPAARTGHRYAFLVKFRQPDKEYMNMKDMTRHRPSRKDRFVWR
EDPRAPMLVSCHEHRRRHFYSVLYDHSEFPWTDGDFIPPPINKLVLYELHVASFSKADGQ
DHGTFASTTARLDYLKSLGINAIALMPITHDDHPNEHHNMPCWGYDPISLFAIHPSYGTP
NDLKLLVNTAHELGMVVVFDSVFNHMHSRSILQFWDGTNLYFEQEGTEWGPRPRFTSHGV
QDYIIDSIVSFFRDYHMDGVRVDSTSNVRGQGSDIPGGWQLLQRINDVVHENFPRAFTIA
EDLYDDRRLNTGGACFDLQWCQGTFKALFNVAEPTKDARRNIGELAQHISRSHPGHMGGR
VLYTENHDTAPGDREKRIPLAIVHGDEKSVGSFYAVMRTTLVASIMFCTPGVPMLLQGQE
IFECASPEWPVGPTVDWKRIYEFPGVNLVFRALIALRQNQHDNTLGLTGPYVRVHHLNES
DGVMAIHRWAKGGPGDDVMVVANFSNKKFSSYRVGFPREGRWSVRLSTSQAAYNDGHHDT
SIDVPEHINVTTHHPRDGYPFSGAIALSRYTAIFLSQNGEARLVFRVKQETEWGTSVGIS
GSDPALGSWTRAIELRTDTADAHYPWWQSDPVVVPARTELSYKMVLLRNDEIVHWEDRDD
RTICPPIGRVRLILS
Download sequence
Identical sequences F2U2K8
XP_004996567.1.12839 PTSG_02082T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]