SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02138T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02138T0
Domain Number 1 Region: 204-298,347-431
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.02e-17
Family Asparaginyl hydroxylase-like 0.021
Further Details:      
 
Weak hits

Sequence:  PTSG_02138T0
Domain Number - Region: 2895-2964
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00294
Family Type I dockerin domain 0.0092
Further Details:      
 
Domain Number - Region: 932-976
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00753
Family TNF receptor-like 0.0047
Further Details:      
 
Domain Number - Region: 975-1012
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0282
Family TNF receptor-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_02138T0
Sequence length 3810
Comment | PTSG_02138 | Salpingoeca rosetta conserved hypothetical protein (3811 aa)
Sequence
MRQTAWLVGLSLCLVLLSVAAGSTSTSSIGSIDSNHNHTVTAPPAPPGPAAPVVLQAFLD
REQLHAESSSPDAARTGTTFVGTDHDALHHDMQGDGHRQQQQPQQGAHQQWDAEDDGKPL
HFSDFFTVHPDLFFDTLYQQETFVNTRPGGAQTLSPSLQAVAKPLGDIQRICDAFEKQPK
KKGGIFIKDEGATRQVTSCKQMNDELDAGAGMVVRFEDLVDCPVKDNVELLRQGVRDVFG
TYSTAHVYYATQDESRALLPHTDPYDVLVIQLQGSKRWTTCVPDAYVSDSNDDDDDSANE
RSNANSTAADRPPSEAEVLAGFNAAQLGQLQEIRSQRQQGCTGYQDSMLRGMRCTNFTLR
EGDTMYMPKGIIHFALTEEQGSSHITISLERKGLAWADALMYGATAAGSVLHNRLFQTRF
KQAMLKLLSDYRGVEFLEAMPSWNLSPGKLCPLDTQQSPLHDPVSSEDLLHMLLAPSDAA
PYAPVMAAAGPPPHTTDRAAFTERYDTLCRAMTPFVHEAYLDAGNLDAYLNPQAIMALVD
SVCNDDTAESVIDKLCEDGRLPIDVTAAKFRSQSQQQQRQQRPQRQQRQQRQQREQLRPQ
RRQREEAELSRDKRAAVVTYTCYGSCDTGCDSCNLCDDGCDTGCDYGCDSGCDYYNCDYY
CDSGCDSSCSTSCSSCDDSCDSSCVIFSLGCDSSCDSSCDYCVTTCDDSCDTSCDGGCDE
GCDICYSGCDYGCDICYDSCDDYCNGNCDYGCDDSCAWTYCDDYCDDGCDTGCDGPCDSQ
YEKTAATATSDRVCRGLTTCGAGEQEKVAPTASSDRVCEACPAGTTDANSDGSDACVTCG
GGTYVPAGSTGTCSQYECSAGTADTDSNAGTACEACDGTTTYQPSKGQERCLSVKTCGAG
EEETTSPSATRNRVCQPCQLGSTFKAQSGQSTRCISVTTCGAGEEEIASPTLSTDRQCRT
CASGTFKAAAGQSTTCIAVSTCAAGFTEDVAPTPSSDRVCVECAPGTFKATAGDGTCRAH
RTCEDTEYETVAPTSSSDRKCKALTVCQDDEWESKAPTITTDRECSPCGRCTDGLTLDKA
CTDTSPTKCVGCDECASDEYTLSSCTLSSQTQCRQCTTCGNDEYQTKACSVSQDTECATL
TTCSSTQFEVEAPTATRDRRCKDLTACQPGEYECTAATLTTDRECCGVTQCVPGSEETSA
PTATSDRECRQCVAGTTDADGSGTTPCVACSAGHYVPRGRTGGCAAFECAAGHVDQDEDA
ATACKLCEAGVNYAGSAGLTRCTSVSECGAGEEETSAPTASTDRVCSTCASGKFKATTGQ
TPCEAVSTCEEDEYVYRAATVSTDTQCRALTACSDEQYETRAPTVNSDRECTGLTTCGSG
EYETRAPTATTDRKCASVTQCDSTQFVVSKPTATTDRDCAECDRCDSGTQYETATCTATT
NRVCADLTVCADTEYESVAATDTSDRKCSSCRECTSSEYLVSGCSESANAVCKACTECPS
GTFVSTACTPLADAECTECTRCGSGYFVQSPCTSEADTTCKRCRSCASGEYLHTACTTPL
PIANVQRSHLAPHVPVHVTVQSTFPGVVLPSPFSSAVSSPSSYEAQLTVGHTGMVSVRVG
EGLVASDTYTLPLRSAAAFAARVLSVELTSTARTARLLYSVRDDLGNVACSSSTATFVLR
LRSPSSSLSLVQVMSECTATSESHGVCVAVLSLPQVWFSPESHTSPNEAIVDVLVTSDAV
VASGGADLDEDGYSQVGTLPLVVPASSASEDVEDIRVRLPTHALTPDQPGVVSVSSSFAF
TAEVFRVKCVSSHPDLVLGEVSIDDSVWTSRASNLDGRSLVVAGLLMNGHRVPNSFGEQE
LFSFDVALADGVDLSGGAPGLASATVSCTTEELSDVSDAVRIPRGATSFPTNVTMSDRFG
QHASGQGRLAVRPTATRALLAHTERAVLVNTGLLTGIETSTQLVVTAYDEFGASSTATPT
ECSLDAGASGAALAAVSANCDAVTLSSSASLPFSSPGGQAVVTVRQGQLEATTVVSVYVP
ASAPSVALDRTSLRALVPREVSLAFGVREPCAAATVFERTRVHVLANFTCTGVDGQACLP
ALPGQVQLDVAQLALELTVADDDVARVKDTYVVGVADGTTEVRVEQPNSGVVLASTPVHV
TRDEVVEIDGLYAGSAESATLSLDHDAVHQLFDQVPVHVRLQSSPLRAEGDVTHVYAFVV
LRDGTQFPIDVLDGLYMVPLDAGQLVPVAPATFAVAAGARNGVASRVRVVWAPPALQGGV
CSDADGGVAGGGGATTPAPPYTYVLAQEDVSVDLQLRKPTGVRLTNTARRLVLETDPAAS
VGGASIPTSMQLSVLLEYSGGGSAQDVTTDSRVHWTLNNQDTGGDVVSIEVVDGKLVLSA
TKPGDAVLVVMVDTPDNPIVTMFSVHVTRSVGLTTTSTPYPPYAGSSSTSKADLRRVFGT
TPPSYQQLQLTSRLVLEDGHEVPLPQGSVVYSTNDKTSTHTDSGGAQISVPSIGVEGNVV
SAVASGVSAVESSFGGFVDDSLTVTATDTEPVYVTALENVHLLSGPTLHGEPNTTTTQAM
VSAVLSDGTRLDNLFSADGVAAVPGLVTWTVEPPSLAVASAVEVDAGTGVITLLGNHYAH
VVLTASTLVPEPNSTASSSLLPNVLEANTTFACNVDPAPGEVDLGSQLSVPLPSVHVSTI
STTSDGNSSSSSSSSGLFDVPVRVNMGEAASLGAFHIIIEMNSSALEFVSATPAFSGHFD
VGATGDEVSLAGLVGDSSVSGPAALVATVRVRAVRAGVHRLRGRVEDLFDRSVPRAQPVG
GSRHGRTSPAADVAVVVFGSRFPTAGSANATAPLHNMARREAALSFGAWLDEPAGSDVHG
VVRRAADSTSGLVGADVDGDGRFSTADALFTLQYTVERDNAFQTVVGVQIQALVNGTQRL
LAMDANKDGAVSSGDADYMLAVVNSKRRFVELPVVEALATQGCQYVVSVSVADRLGNAPD
PANTGVYVLLESTSTSFSRALVSRIADLQQEAAALAQLAATATNDTTTTTGPSTSANANS
TTASGFSGAGAPHLPRTWLMADLNATSRPTRAVLLPLVPQADTGASSHATVAVGGATYVG
TFPAPLLSSSELAQLADDPHLGLSVIEVTRTNLGTTAYVHTGASAAGTRTFSPLRVTGLG
VDGGSATDVVLTVGPTYGYNPMQFVKAAIDVRNACTLSCGEGEYGDIDAWVCRAVRPCDL
SSEYMVAPETPTSNRVCETLTVCRPSSKYETTAATPTSDRVCTPLTRCHPTQEFVSVNAT
ATTDRVCAPLTTCDATREYEVRAPTEYTDRVCGQITACNGTQSEVAAPTPTSDRQCQRFE
TQKSASASSMLSVIGPAAGGVGCLLLVLALIAFVRRRRSRTSVDAASTTSRDVFLKVNPM
YDEGVAQKRRGPGDDDMFYEDPQTLLGFDASLFEGGMHHAKNPLYVGYDEEGNPKGKKQA
FADDDDDGLVAVLDEDNGYVDIDDKPTTASKDYDLFDLYAEPEAVLSKRASRRFSVSSMN
EDTPIIRNPLYQGISDDDDDDDDDDASFGFAPGPEYMDVEGTDNNTAAPVGDEYMDFDAA
PSAAGRAKKSPKKGVTYDNPDAFPHDPTDEYMDMASPAKRGGDYAAVYDTPGGVDEYMDM
NAASTTRGSEYATIYDNVDDGQAEQYFDICPNKQTNDDVYAMIYDAVAQPKDESTARAGP
GADDDDDDEGGDQVYMNIDEDPIYDHNYIASSTLEAVDPFADTYFNVDDQDRAAYDAVDG
GYGFGNVADDGDEPIYDSPDVFNEDNKDHN
Download sequence
Identical sequences PTSG_02138T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]