SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02178T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_02178T0
Domain Number - Region: 23-166
Classification Level Classification E-value
Superfamily Tropomyosin 0.0386
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02178T0
Sequence length 575
Comment | PTSG_02178 | Salpingoeca rosetta predicted protein (576 aa)
Sequence
MPAGRGNDDEVASSVIEFLKTEHKKTLEALRKEIAQLRDKNTDLNYKLTLLQDADTEQQQ
QQQQPEPTTAAAQEAKIEALEQQCHAHQQARHALEQELNMLRAKLAAMDETVAERDAVIR
TMTTEQTSLHKQCAALEQEVQRLRDDNSRYSRRQAELVMQLRNARATPSPAKHHAANSQD
HAASPDTAQRTSSSGSRTPNSVTTLASPRPPHAVGGPRHSRTTQPSPSAPHEPGSSPLSP
TSPATPPSATRRLRTPSVTSPLRSTAGNSSGGGGGGVVVADMSPPRDPRQSTRASRTRHR
RYARPAASPTTAGVGTDAEYIQRETERLRLVSASARGSGRRRLGSANYPVVPPIAPSSPS
PTSSPPPPSLHGRIHGSREGGEVLSGGNSTDTSKRRPQHQASPDHHHHHHHHHRDGGDEA
YRPSPPRGPVLSSNHRVRRSWERYETTSTGRSHHTNNNDNSSSGDSTTGHHGLGVDGRDH
GAQSGPMRGQDVGVDDNEDDADPHRAAGRHVGDGGRVDGGGDGMSPASRATAAAVAPRRK
KGAGVRGGHRDQHMHTPPTAVRQLPTPPSPRINRS
Download sequence
Identical sequences F2U1F8
PTSG_02178T0 XP_004996664.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]