SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02182T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02182T0
Domain Number 1 Region: 19-290
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.56e-63
Family Amylase, catalytic domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 319-394
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000264
Family alpha-Amylases, C-terminal beta-sheet domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02182T0
Sequence length 432
Comment | PTSG_02182 | Salpingoeca rosetta alpha-galactosidase (433 aa)
Sequence
MIASSWPFQHKDCHNGDNKYFDRCNEWEIRDIAEAMLTNGMYDLGYRYINLDDCWAATER
DAQGNIQPDPDRFPSGMRAMADWLHKKGLKFGLYTSMGSATCNRGGRPKDIPGSFGHYKE
DAATFASWHMDYVKVDWCGHDLFDSKLQHTELSNALNATGRPIWLELCRGYSYDPIPPYV
AEVAQSWRATGDHQDEWSNSKTVIQAFMNPSNPSVPHAWNYGDFLMTGGPGCNVNASLHC
PRQTDDEYRTTFSVWSIASSPLIVATDIRNMTAIMTECLLNKEAIAINQDYTSAAGKLIG
SDTRDPVCASGGDGDAPTCPVFGRKLSDGTYAAVLINLADSGRANVTMDLGWLGLPSSAT
VTVNNILKQRSMGTAKGTLTVPLSPHESVYVRLTRTTTTRNDTSSADGVVTARVHTSGEQ
QGPVTMVLDRNN
Download sequence
Identical sequences PTSG_02182T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]