SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02226T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02226T0
Domain Number 1 Region: 2267-2447
Classification Level Classification E-value
Superfamily Fibronectin type III 3.41e-35
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 1591-1768
Classification Level Classification E-value
Superfamily Fibronectin type III 5.42e-35
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 816-998
Classification Level Classification E-value
Superfamily vWA-like 5.88e-33
Family Integrin A (or I) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 3963-4137
Classification Level Classification E-value
Superfamily Fibronectin type III 7.07e-32
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 5 Region: 4551-4721
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-31
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 6 Region: 2653-2783,3053-3106
Classification Level Classification E-value
Superfamily Fibronectin type III 5.21e-29
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 7 Region: 2451-2648
Classification Level Classification E-value
Superfamily Fibronectin type III 5.27e-29
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 8 Region: 1029-1203
Classification Level Classification E-value
Superfamily Fibronectin type III 3.27e-28
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 9 Region: 1304-1497
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-25
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 10 Region: 4731-4906
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-25
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 11 Region: 4906-5105
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-25
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 12 Region: 3104-3233,3818-3863
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-24
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 13 Region: 4368-4521
Classification Level Classification E-value
Superfamily Fibronectin type III 8.03e-24
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 14 Region: 4146-4336
Classification Level Classification E-value
Superfamily Fibronectin type III 8.07e-23
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 15 Region: 1463-1591
Classification Level Classification E-value
Superfamily Fibronectin type III 5.44e-20
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 16 Region: 1176-1300
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 17 Region: 134-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-18
Family Laminin G-like module 0.088
Further Details:      
 
Domain Number 18 Region: 3875-4002
Classification Level Classification E-value
Superfamily Fibronectin type III 2.4e-18
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 19 Region: 1763-1860
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000129
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 20 Region: 1977-2132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000119
Family Laminin G-like module 0.03
Further Details:      
 
Domain Number 21 Region: 1852-1897,2210-2254
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000723
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 22 Region: 559-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 23 Region: 327-395
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000161
Family Galactose-binding domain 0.052
Further Details:      
 
Domain Number 24 Region: 501-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 25 Region: 720-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.0077
Further Details:      
 
Weak hits

Sequence:  PTSG_02226T0
Domain Number - Region: 683-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family Laminin-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02226T0
Sequence length 5480
Comment | PTSG_02226 | Salpingoeca rosetta laminin alpha 5 chain (5481 aa)
Sequence
MRLVGPSRGCILALSLLVVVVCLVTTTAATGLFPSIENAARDKPVSVTSSCGFDGDINSF
CDPTDDGVTAANACNGQAAMVCNATCPYGSAAPQQYDLLDPDTISYFEDVTFRPNSIELG
ATSQLLILSSSAAFPPASSAATGLTLAARIRTTQQQRTCVVSKSASGSPVFSLCLRGADN
VLEFTAGSDVTSFNHTGSGPVVDGAWHHIAVIVLQDQARFYIDGLLAGTESATFPSDVNS
GSIVVGQGFSAADVFIGELGGVYVYARAVEIYDICTLAGTSPCQQPTPDDGCRCPASHPI
TADDNANQCVATFAASGPRVQRTNIFSYGASAAVDSSAATYWRSGRNDSPVNVTLDLQGL
YEFMRLEVSFVSDRPHSMVVERSADGGSTFSAYRYVSRDCPSAFGLPTLSPNDAASPDQV
ICTLMPDGPGAVDFILFEQGNLPEYLPADLADVLFPFSQVTHVRFHITQLAGTYDEQPGD
PALRDSYVAISDVTVTARVLCNGHADSTRIAERNRRPFEICDMCAHNTQGDQCGQCAPLF
NNAPFARGTGFETNACDMCECNGHASACAFNATLNTGICSDCDSQTAGDNCDTCDVGYYR
AAGVSADATNPCQPCSHCNANGVDPSIVCVPDPIQGDAGTCACVSPYIGSTCTACIDTFF
FNASTSTCQACACDDDGASEARTCDAQGVCTCKAGYTGDKCDACADGFYRSAASGLCVAC
ACNTAGTEQGTAVCDKATGQCPCTSTHTSRDCGECVDSYYLLPNQTCAACSCFADGSVSS
SCDSDGVCMCVQGGDYVGDKCDVCRPGLTANIIRQCADATGDVMFVVDVSEGVSETMLQA
VRQFLSNTISALGVGETATRVGVVQYASGAAIASDLNDHFTVAELQQVVSNLALTDTAPL
LGGALNVARSVLRSSVQGGRTTAPDTVVVVTATTSEDSVNTAASILEAEGVNVIVVGVGA
GISLSQLQAVVSDADNLHLTANATLLAAVDLDLELTSALCNSLQGARCDRCKDGYAGLTA
EYALACSGLPSAVNSTEVSLAGDQAVLVSWTAPTDPNGIVEQYTVRRNGLVVIKVDGNVY
TYRDEDLQPGDTYTYTVAATTPAGEGPESALVLIRIPDTQPEGLAAPSVTEVTPFELSVS
WSPPSSPNGIIVGYTLLVNGARTSVGISTSHTLAVYAFTTYSIAVEACNSEACAVSNATS
ITTSPAGVQGQGAPTLTATSPRALSISWSPPTALNGDLQNYRVELQQVPGGDVAVVFTGT
DTETTVSGLLPFTTYRARVTTSNVQTTESATSPWTNTTLPPAAPEGVAPPSLVRLQARTA
IVRLAPPAQPNGITESYTLVLNGTDVDTAQAAGNRTLSSLLPYTTYSLVVRVCTEDAGCT
TSSALVFTTVEDVPEGLTAPTVAALSPTRVRVTWSRPTQPNGEITRYDVQRVHTPMDGSS
PETTTTTTITEGLGAASLEIEDDVSPYERYTYSIIAFTSAGSAASDPTSITTPEAVPTGL
APPVVSDIAFTSAIVSWSAPTSPNGALVQYHLLLREEGDTTDEIVAEGLGTNASLTLLTP
YTGYRVRVRFVNSVGVVTSDFTDFETLQAAPDGFSPPQVVSTTSSSLTIQWPAPATPNGV
IARYIVHVDARTIETAPTLRQVTVTDLLPNQVYSVFVEACTEAACTSSASITGTTDKRAP
AEPEAPQATPLDPTTILVRWAAPSSPNQPLTHYELYRNGFVVFTGLNTTFTDEGLTPGTS
YAYAVVAYNDAGGSTSPSTVAETPEDTPAGIAPPTLSALSSTSISATWTSPSVPNGIVIS
YALIDLDTSETVCTGDAALRSCVVSELSIYTLYTFQVQACTASGCGLSADASVRTNAAPP
VGLALPSLSAVNATSVSVSWMPPTSPNGPVVAYQLWVAAHFVQTPSGMSMSLPSNGSSTT
TMTSTATTTAAQTTTASTMGGTTTPVVSTQSGPTMLNLLDPGNVNGTAVQNADGSWTFAD
DAFLQLLSHGMRITSRFSIAFDMQQTPGNSGYYLAKSDALGRRFFSLYNTATSQQLYFVY
RVPGATDIRFTRFTTNLNDGNRHKVLVSVNGQSITVTVDGSVVGTNTLDAEVDDCGAASD
DCIFFMGQKASLTGDTLNFDGTMFAAALFPDSALTEFPQLEIVQVSWYAPIEEKYNDLQY
RRRALTLMTVDDIVANVTAYANASCTRGLTRRRCGVDILHNHNHDHDHTSATDDNVTSTI
DAVYEGLDTTRVVTGVRPYSQFIAFVRVINTAGSVDSSLRATITPQDAPGRVSAPNATAI
SASAALIEWSAPEFANGIITQYQIRVRAAGNQGRGSAVFTGFAFSHIATNLDPATSYEAQ
LIVSTSAGSTASAWTAFTTREALPTGLADPVLSDIQATSARVSWSPPSSPNGEITRYLLL
VDGTTVFNGNTLETTLSSLSPGTSYDVQLQACNTLGCTSSTATLYTRETAPGGLATPIIA
SVQARAITLAWQPPTSPNGQVSYVVQRRELTGDENSPTPLATQNITEPTTDTSLVDTNVS
PFTQYEYRIAAFTTGGTTLSGWVAVRTSEAAPEGIAPPTVIATAPRSLAVTFAPPATPNG
VVTSMRIVVSAASGTVLTVDATGTRSLNITDSDALSAYTTYDVALEACTDAGCSTSQPSQ
VATPEDDPVDLAQPVVTTINSSAFQINWLPPSQPNGIITTYILIIGRVTGPPAIVSLNGD
VLSYVFADPAFVQPYTVYQFLLQACNSISCVTSLSVDARSGEVPPSGLASPTLVALSNGD
VSVSWAPPENANGQITEYIVFQQQGSSSLARRRRAAGNSTVPVSSTATAATTVTTPPGAG
GSTSSTPPLDPISSTSTTTAQMSPVTSSSSTATTAAPTTPLSSMPLPSTVPAAATTGAGP
IASSSAPAASTSTSTSLPPATTVQQTVRMAGVSAADVPLPLVEQVYLDALDAKAQEVTAE
LKDSNSTLLRRRRRRRRATQEGEAVLVVVTATVPRLDDVSDAVQAMQHVVWSGTLLTALQ
FADPATFRDATITVAQDAAAVADSTTPATGTSAPASTTSTIAATTTTTTTSATTEEPVIV
YRGLDTQVIVSGLLFNTEYTFVVAASNGAGSVFSDPTSVHTVDGPPSGVAAPTVAQDTPT
SVRVVISAPDMPNGDGVSYSVLVDGSASADASEAGEVVVNGLQPFTTYTVAVQACTTGGC
TTSSAVSIRTLSDAPADLDAPSVTATSSSSLVVTWMAPGKPNGMLLDYKVWLRELEQCSI
AEYREENGYVVQSEAGLPTRDNDGLSCRFVTCPLGLSACGLTCYDPFNEACCDGQVHDRQ
SGHECCGTNYVASDGSGDTTCCGGQLVPTRAGFGCCASRYVSMGADQVCCEGQVQTGNEC
CGDIGFVNTPEQPRICCGGQVFDSFSNRQCCGGSIVSSQLVCCGGLDTGIAHDPMEEFAC
CGTDYVHGPTSTCCGEGADAQAFTYGTAEEKSQDSRTCCANDLIAQSQECCNGRAYDPTT
ETCADRTSSSSSTIRECSAGTVCSGAGSDGAVCGSCDFDNTQQSCFAVDVTQALADAAQH
PDRTLVVPPQEESQCMYVLCGLDESVCGATCFGPDEVCCSGKVYQRDSSRRCCGTSYLPR
TSGDVCCGNALYPSQPGHACCGSRYVDIPDGSVCCDGLVLDGDSCCGAEGYYAVDVGDSM
KCCGGQLLETTSGIQQSCCGSGLIVSGEVCCEGVSYEQQDGYACCGSAYVREDSSLCCKA
ADGAIVVHDYSSASAKALAGEVCCGTSAIPSHLGCCNGEPFDETEYVCADRSSGSRSSCA
AGRLCPVSQADSAYCDSCSFDTAASVCGVAVGVPFTPECSATPSLAYAGPGFTATVNDLK
EDTRYEAQVEAATIGGVARSGWTPASTLSGELPAPRLLVLGNSSILVSWDDAPTEFGVVQ
RYELYRDGTVLVFSGLSTVFEDTGLVPGTMHTYEYVAVSELTTTRSRTANATTFTSVPAG
FSAPTCTALGATSVQVQWTEPLQPNGIILQYILQRGDSPDTRTNVQLSLAEVVQGLEPAT
AYTFRVFACTETGCKGSPPCSATTDEAAPTGMRAPTTELAGGTQLTVQWLPPLQPNGVIT
SYLVQTRPVAAGASVTFTTAATLDPSMSTSLEASVILLSNVEYAIRVVAVNSAGNATSPA
VLEPKPPVSVSAPVVVPPVLANEVTLAWAEVTTFVSYYAVVLKEASAPDSAYTLAHIGTE
ARATINNLQAGRTYSAVVVAGNAAGNTSSSATTFTTAAQVLPPEQFAQPTATATSSTSAV
ITWTAPLVPNGEILEYRLLRSGPFDADQDYDAATTDPASAGELIHQGLGRFVTDESLQPY
SRYFYAVLAVNAGGATRGTSSSDSSVDHAVLTTLATLASGLSPPSLQPNNEALLASWVAP
ERLNGELGAYVLEGREVQEPALQPVVLYEGENTWFNVTGLKVFTTYQLRVNVRNSVGTAV
GPWASATTCGGTPLGVAQPSVTSRSPTAIQLTWPAPTALNGVLVSYNLMRDGQIAAQVQT
RSFLVENLTPYTEYTFAVETCVRDPCDNEELCATGPALTTRSGEGLPTGLAAPTLEVLGA
SSIHVSWSPPSSANGVIQQYQVLRGEVVVYTGIALEYMDTSLEPNVMYTYRVRATNGFGS
VTSAQRAAMTLIGTPANISAPVVTVQSDTSALVCWSPPGTPNGVITNYIIVLDGEDLPQG
LAECAPLSGLTANTEYSVQIKACTNQGCGISPVTTFVTRCTTPASNSPDTITPGTTKVTL
SWTPPTQPSCAVLRYIVFYGRDETDPSTISVVDVGTNTSVTIGGLLPYTRYSFQLQVSNE
RGSVKGAWVATRTLEGIPRDVPAPGFIIRSATQLIVVWNVTSVPGGPITEHVLYQDGARV
GTFQTPLYEADDLTPFQEYTFQVETCTVSGCTRSEEAMIRMPEAAPEGQGQPAVDNVLAR
SFHVAWSPPLNPYGIVTAYQVYVRACELASSCTSQAQLMATVNGTATDTTITGLTPYTIY
QVQVSASNSQGVAASSFTTITVADGQPQLLRTKEDVPEVVGPLTCTVDAQLEVACNWDQA
FEANGILLEFEVTVRDRSRNDDIVSSDFVAADKRDFSFFGRATTYLVEVTAVNSVGVATA
TQVVVAAPSTTTTTTTAVNSTVVPVAASGSDLTAGGIAGVAAAGGVLLLLIIIVLVQRST
RSRVHEMSTVPTEDKGKQFWQVEEELVELRPKERARPLVSPRQRATHYFYENPHARPDSR
TWRDEYSESEADSYSLGGPGAPGQPMGGYPLRRRTSSLHGLLHNQHVQVVGQRQLDTPRS
MQSEGPAESPHPASSRGAGAHGAWTIPPADMAPQHQHQHQQRNPYQQQHQQQPPPPPQFQ
SSPPPPPANDDFADLRAMLQEQQRVMQQYAARSLEQANMSLHSQSPSSSSQQQQHPQYQQ
QQHPHRDVSFNDAGVAPTHPDSGYLQIAPVPASHVDEPDTMEMRQVNQDAVSRADSEAPL
VFTEAPTTLDYTQHEEDTWL
Download sequence
Identical sequences PTSG_02226T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]