SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02298T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02298T0
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-42
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 269-342
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000575
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 
Weak hits

Sequence:  PTSG_02298T0
Domain Number - Region: 165-235
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02298T0
Sequence length 401
Comment | PTSG_02298 | Salpingoeca rosetta predicted protein (402 aa)
Sequence
MSGRRETTPLHKAAIKNMLTVAQVLTQRGASVDAEDEIGYTPLHLAAYVGSTSILDHLLH
CGAAVNRQNEEGDGYTPLHLASQEGHADIIARLIDHNANPNVQNEMGDTPLHLAARNGHS
AAVRALLKGGADPNMRDEEGLIPADGCTNPELLSIFEEFSDGRKKEDPHMTELRTRLRQA
QQMASIAQREVITLRQRAQAAESALAGSRRTIASLHARNRELEEELARLKAKQHTRPRGG
ANPTNVLPTDASEQSSGGDGSVFMSETEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQHSPQQSPRRSPQVSPHRQQQAPTTPPANITSNANMGLGAEAQFLTPHHRPMRSRST
RGSSSSEKPRLPSPLSTSSSAGQRTTHSRASSTASQTEEQA
Download sequence
Identical sequences F2U1T1
XP_004996787.1.12839 PTSG_02298T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]