SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02307T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02307T0
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.41e-20
Family APC10-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_02307T0
Sequence length 139
Comment | PTSG_02307 | Salpingoeca rosetta predicted protein (140 aa)
Sequence
MPNVCKESEGAHVVLATSWDPEHPPEALVDGEEGTFWSTTGMYPQEIVITFPAATRVTTL
ETKSACIKNIVIQKSSNQSPAGWDDLTSTELTHSEGHVQLEDHKIDPCIIRHIRIIIKSG
YEPFVALYSIVMEGTPIES
Download sequence
Identical sequences F2U1U0
XP_004996796.1.12839 PTSG_02307T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]