SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02506T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02506T0
Domain Number 1 Region: 64-273
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 8.81e-27
Family Glycosylating toxin catalytic domain-like 0.027
Further Details:      
 
Weak hits

Sequence:  PTSG_02506T0
Domain Number - Region: 368-462
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0221
Family Galactose-binding domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02506T0
Sequence length 681
Comment | PTSG_02506 | Salpingoeca rosetta predicted protein (682 aa)
Sequence
MHDRHHNHHHQQRAYTLEEGLKQLLLLPGSSEEQGEDDRPRNVPRLHWEPQNSSVVAGQA
CQHCPVEIPRIIHQTWKTEELPYLAQSSVESWQRLNKGYEYRFYTDDDIAAYMEKNHPNL
VNTWNRMKPIHRADLFRYVILHDVGGYYADIDVTLQTPLDDWPLKHNIHYSAAVIVGFEI
ITQRPDWKQWFSRQYQMCQWTMAAAPGHEIFARTIGIINENFKSLSDTDIETMSAVKLTG
PAVWSDAVTSHLHDHYGVAFGQGMFTDDRLRDNYVLIGDVLLMPMRSFAVGSAGYFPPSS
FEWSDQLVTHGFQGSWKKNPNPQYVDFGQEEAVIPFVPLERTSTAVLLSAKYGIQGQPST
PLTSPYMEPLENLFDGSTDTKWLGYHDFTGEAPPSANVTIALYPRQYAQLREYELVSGND
MPNRDPVTWQVVCVGEHDVETVIHSNDGAVFTDRVQAKAFRVAMMAVCRSFVFVFKQVVN
PHKVDCLQLTALRLTDLTPARPSEPECESTSFGQLCTCCTLDIRGSEGAMNVLDESLSTH
WKASWPAAISPDDGGGLELRPSLRFVFSGGARRVSGYELAPAGDERAMDPAAWRVVGKRD
EKEQRWEQVDIRSGAVFEERAAPLRFHFEQTRPFAVLEWQLLSAHNSTHPQCVDGTRFCV
QLARFSWLFDDEDGQAESNRQ
Download sequence
Identical sequences PTSG_02506T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]