SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02537T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02537T0
Domain Number 1 Region: 546-730
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.94e-16
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 
Domain Number 2 Region: 452-504
Classification Level Classification E-value
Superfamily PA domain 0.00000000017
Family PA domain 0.005
Further Details:      
 
Domain Number 3 Region: 118-240
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000994
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 
Weak hits

Sequence:  PTSG_02537T0
Domain Number - Region: 348-388
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0262
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02537T0
Sequence length 1005
Comment | PTSG_02537 | Salpingoeca rosetta predicted protein (1006 aa)
Sequence
MHLRMLAACSRHEPVYDQVTSLADKPQGVTSDDVHASLFSHKRNLLTGDTAIDARRTASV
PTGAQQRSAQNEQPQRRQRRAAASDDRCGSKSDDVALDASKISVATHSFPSDATEISFLW
VGQPRGEIVALVTRELQRQEPNVYCSSDYGRNYTLCPGIKWPVVELHRVETLDAIWVYAL
PSPSESQYFSKDDYRKSAGFYLSTDNGRTFTFKPLDMHMHRILPNPTNAHEMLGFVPDDD
HSDYEVDDLYHLSEYGSEQAQLLRISEHVFYADWAQENAAGNDDDVLMTVYRAEPGEVVP
LDLVRMHRPGTRDAKTSMLRKNCYDFEQAAEFLFATEVPSSDGFDERRLFVSKDNGDTFT
AAVFPFDARHNHFKIVDATEGVVFALVQHTLTRTEGDTFVFRVDSPPEIAGNFSATKGLF
TPALTGNVLSGTLFIEKQNPLGCSDRGGVSPEAKGRIAVVQRGECKFTEKTLNAQAAGAI
GIVIVNDADTLDFRMAGEEGLELDIPAFMVQKSTGATLEDTFDKNGVDIIASLIEDNIQE
QEIMQTSNLFVSDASGIDFTLSLQDVAYLPYFSSTGTEVADVHKVASQPGTYLATWLKND
RMETVITFNKGASWSHIPPPHGARCEDDDEAACQLHIALDAARAIMDLPLPMSTPTASGI
ILANGFAGESMTFASSEANLYLSSDGGLTWSLAAETPHEYQILDHGGVLVAVPYFQTTDS
ILYSVDRGTTDWETKKIAREDTILQMTAETGGGTLVVYAYYYDIEWRGAAVDFEPLLGRP
CSTAYLGTANADYEIFSPGVPVSSGSDQRCLLGQQHKFLRRIACRICFNGLDHEPKYEAA
EDQGTTICKCTAADFACAPGFTRKSDLSATSPCEYDKAYKKEIACSGRKEFEDVRNYAKV
VGDVCSGGEEETYQQTTSVECSNPGADTSMAVVSVVVVIAFLVIFITVILYKSPSLRERV
SGYVPCFRSRSTVSFSQLTNTNINDDLMDSDDEMLIGTGDATAQA
Download sequence
Identical sequences PTSG_02537T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]