SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02559T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02559T0
Domain Number 1 Region: 82-339
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000000116
Family NagZ-like 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_02559T0
Domain Number - Region: 777-821
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000151
Family TNF receptor-like 0.0046
Further Details:      
 
Domain Number - Region: 619-679
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00429
Family TNF receptor-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02559T0
Sequence length 1139
Comment | PTSG_02559 | Salpingoeca rosetta hypothetical protein (1140 aa)
Sequence
MAQTSMTREACATLCYTFNFFTQAPLSMATNAASANTQAEFHRAVSAPSSDCNEPCTGVS
TEMCRAANRMNINPGKLFRQTRSRSLSIGARLDDLIGRLSLQEKAGLIGPDPVTSPCAFL
DYGIKRLAIPPYLHLVETNTAVASACIISQDKCATTFIEPQSLGAAFNRMCVISTEMRAF
NNLSRHRGGSVLQKIVLKSTDPCLSGEYAAAYVAGCQDGPDRKYKKMTAGLKHVNAHSVE
TTAWHSTGTSPPLTSGTPSINGVSSPCANNMLLNDVVCGQWKRDMTLNGSADMELGETYF
TTNGHLEQAVKHNRMTINTAHNTVRRILKDSFITDQCNGRCISECPDDGEYELGQRVCRV
PLHACAKCYPTGRHRLPPLRQQSHQSCIAHCPLDYFYAKDHRCVPCTTCGMCTWASTSCS
ASFDVVCSPWTECKPAAPFGMEYQPLPDRASCFPTSVCEEPFIETIPPTLTTDRLCSCDT
LTCNKLITQLFEEIVCAEPTDEQLDVVLDVCCSGQGEDGIRDTIRQMDAYEARRSCPGCT
DTCECSAGFILVYDADSADCRPCDSVTEFSPSIGGSKCEPIEECERGQEEDSDGSTGCQM
CPAGHYTEAGCHGSCSSFTCRAGTHHHHDSDPTTTCMDVTECASGHEEVQAMTLLISDRV
CDECTEGTHKAVSGQGVPCLPVTTCDAGEEETAEPTPTSDLRVQPSTFPRMAVSKCEFGT
FQSQVPTLDSNRECTLECSECPSGRFEIRACSTLENVQSHLPRPDPVQPVDGVRAHRLCH
LITKCDPGEHRMRAPTSTSDAKCEPCPIGSTDHDRNPLTACQPCPCGHYVPADSIGSCEQ
FLCPAGTADLDRRNASTRRVRRARLAWTLPPSLAQRDCTPVTECDLGYEEMVRPTIFTDR
QYRRCIEALFYRDSNTDFSTRRHGPRVPDGPHVPQQQHVHLVPAHAHDAEPQASARRGRS
ACLTEYELVAPSLVNDRECQRVRSCQHTEYERRSLRCSHRACVPAYSVSLVFDAKFNALA
DTQSRHEAFEAALVQSINHDAGRGTIIATVASINEDFTARLFNRSVSGDITVMAFTASPC
EADAFLDDSSLWLHGKLLKALDAVGSWTTTALLGETLAAVVVVWWWRTPWQQQRQLMRW
Download sequence
Identical sequences PTSG_02559T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]