SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02568T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02568T0
Domain Number 1 Region: 917-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000794
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 496-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000227
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 241-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000249
Family EGF-type module 0.005
Further Details:      
 
Domain Number 4 Region: 390-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000249
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 867-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000249
Family EGF-type module 0.005
Further Details:      
 
Domain Number 6 Region: 1132-1171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000249
Family EGF-type module 0.005
Further Details:      
 
Domain Number 7 Region: 190-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000321
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 8 Region: 1463-1686
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000327
Family Tropomyosin 0.008
Further Details:      
 
Domain Number 9 Region: 337-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000499
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 10 Region: 1185-1224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 11 Region: 1079-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 1026-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 13 Region: 973-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 14 Region: 814-853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 15 Region: 761-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 16 Region: 708-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 17 Region: 655-694
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 18 Region: 602-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 19 Region: 549-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 20 Region: 443-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000522
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 21 Region: 1246-1284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000498
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  PTSG_02568T0
Domain Number - Region: 1733-1800
Classification Level Classification E-value
Superfamily Tropomyosin 0.00497
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_02568T0
Sequence length 2459
Comment | PTSG_02568 | Salpingoeca rosetta fibropellin Ia (2460 aa)
Sequence
MAGAATAATAVLLALLLASPNAHAGDWECPTYSAVDNFEVSSYSNNDGNFNWNGPWVEED
PNGGGVTSGRVRIENGDLRLDDIGSTRQRIAATRSVDLSSADHSATLQLEYHTVGDVERT
DEFVIEVSKDGNSFVALDTISATSCRDNKQSRIYTISKYASRHTTIRIRIKDGFRGRDEG
IIIDWIAVTFSSNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTEN
DICDSNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDTNP
TTAGTTSATAPTVQGPSAARSIRYTTTSSRPTSTENDICDTNPCLNGGTCKSKDHGRDYK
CYCPHGYKGERCEINRYTTTPSRPTTTENDICDSNPCLNGGTCKSKDHGRDYKCYCPHGY
KGERCEINRYTTTPSRPTTTENDICDTNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEI
NRYTTTPSRPSTTENDICDSNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTP
SRPTTTENDICDTNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTE
NDICDTNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDTN
PCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDTNPCLNGGT
CKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDTNPCLNGGTCKSKDHG
RDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDTNPCLNGGTCKSKDHGRDYKCYC
PHGYKGERCEINRYTTTPSRPTTTENDICDSNPCLNGGTCKSKDHGRDYKCYCPHGYKGE
RCEINRYSTTPSRPTITEIDICDSNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRY
TTTPSRPTTTENDICDTNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRP
TTTENDICDTNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDI
CDTNPCLNGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDSNPCL
NGGTCKSKDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTENDICDTNPCLNGGTCKS
KDHGRDYKCYCPHGYKGERCEINRYTTTPSRPTTTRAPPTTTGDGPCEPNPCENGGTCEV
YWWLFFTCHCPEGVSGRTCEHVDTTATTRAPTTTTTEATPTRPRTTTPRTTAATTPRPTT
TTTPAATTLPGYTCLKARQCEAAPPGEKYCNTAVLQLNCGPRRVIKVAHAFYGRRDKDVC
PDPLLRDGSTDLTTCSIQATDLVADICDGEEACRVSACNSVFSDPCVDTYKYLEVDYQCV
DEDDVDEEVRCGEHTTTRAPTTTTERRTTTTERPTTTTERRTTTTERPTTTTERRTTTTE
RRTTTTERPTTTTERRTTTTERPTTTTERRTTTTERRTTTTERRTTTTERPTTTTERRTT
TTERPTTTTERRTTTTDRPTTTTKRRTKTTDRPTTTTERPTTTTERRTTTTERPTTTTKR
RTKTTDRPTTTTERPTTTTERRTTTTERPTTTTERRTTTTERPTTTTDRPTTTTERRTTT
TERRTTTTPGGDVCGDLTATRDFLGNLIFCGQSGHACPGGSFCGSRDYCCDRAEPSTTIT
ERRTTTTERPTTTTERRTTTTERPTTTTERRTTTTERPTTTTDRPTTTTERRTTTTERRT
TTTPGGDVCGDLTATRDFLGSLIFCGQSGHACPGGSFCGSRDYCCDRAEPSTTTTERQTT
TAERRTTTTAPGTRTETRTETKMETTRARTTTAPRTTATATATATHTRTRTEATTTVPAT
HTRTRTEATTTATATRTATRTRTDAASTTTPMSRIHYVTITFPDIDFFSVFTHPSSARAL
EFAGAVWERLVEEDVAGPKEIRTIDVSLGSNGIDVIVGAINADAADRIERYVGARAFCMP
VSEVQIVLCTSGAHRQLTTTRDTRATTTGTSARRWTTTTTVRISNGERVGADNSNGGNGG
NGDSGSTGDGSGFKFSTTTSIILGVGTLIIAIAVIAVLVVRRQAKRREALRSEQFAFSDH
RRRKSSITAFAQALHSMSATDVSTPPAYASPQHSAPPSSTAPTEVEVARINTAHAHHAYH
HADPSSDASSATYDRATYERASSAGYDPMAQSTTAGGIRLLPGRSTHGDDAVVAGYTAAS
ASGDYDIASNHYGYSSTRYDNADPYAVAEPDMTAPEQAHILSRQRRLSRGNLLSPRTNAL
YTRNAPEIVAASNVTRANAPPPPPFPLHESKRKKRVVISADVRDNVPLGAPAKPPRSRTS
MDESSTDDADVDAEMQRLHLGAGRRSEEHELKSILSRARAATPTSAQLRHRTPTPSLDV
Download sequence
Identical sequences PTSG_02568T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]