SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02656T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02656T0
Domain Number 1 Region: 4758-5108
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.37e-74
Family Hect, E3 ligase catalytic domain 0.00015
Further Details:      
 
Domain Number 2 Region: 3071-3417
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.84e-70
Family Regulator of chromosome condensation RCC1 0.0009
Further Details:      
 
Domain Number 3 Region: 93-369
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.4e-50
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 4 Region: 2646-2772
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.07e-22
Family APC10-like 0.0058
Further Details:      
 
Domain Number 5 Region: 4280-4431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-16
Family SPRY domain 0.025
Further Details:      
 
Domain Number 6 Region: 1874-1999
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000123
Family APC10-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02656T0
Sequence length 5125
Comment | PTSG_02656 | Salpingoeca rosetta conserved hypothetical protein (5126 aa)
Sequence
MSSNKLAYWEAKGDLASSFCRPDHLNALWSKLRKNRVVDDDDASSSLLHDSRLSHSAIGW
SNITPGELCDSLQEEHRARSYFLTSNLSQLNPLHIALASKATFLWSCGPPTSRLLGHEGH
TLKLVSGLENERFVQVAAIDHVLALTTRGEVYSWGSNSYAQLGRNDDPIVPTKITRGFGR
SSIVYVAVGGQHSAAVSEDGVLYTWGRGSYGRLGHGTSDDVAFPQPVLALKSKDILIATV
ACGIGDAHTLALSRDGVIYAFGDGDYGWGPAPATGGASGKLGLGSTERTRVPVAIPCDFD
GTKVKQVWCGRQISACLTEGGALYTWGNASGGALGNGESYGAVESPARILADHVIKSVTA
GPSHIALWSGDVRSVSHSLSPFTPSANPALLEAFARLLEQFAGSDITQDEHATAAAVSTC
CLLERTFQVASRNRLGDISSIRARLRQPLLDLAVGTRPCPDQLRTAARFCVLQGWDLLDV
PDNDRQLLLESITSIVFRSRDPPPTAEEEAAARQMLRTRWKCLMPMKERLRWLSRLLPES
LASTQQQQQQPREQRSFDSDSSTGRPESRDSTATASRPADQQGGDGAGSGQATASTTATT
TATTSPTSAAAAATTAAAAADGGGDETRTGHQFMVSVIVNSLFQQGVVEQAVNAFFNSPP
SQQEQFLFQADLLLSSPLPSPALTPSGLGSARSSSFDVTAGQQQQQQQRQQQRASSSTPL
TPTTTTNMRLLTQRSQLSSQAETSVYSPTGFDESGSSSRIMSPPATGQLPPSTPRAVRMD
AFEQSGGHTAVGLATDLQSMLFLLNIFVTTMKTRTEQVAQRIHRRQDIPSADSDDILLKL
CHRFLRSFFAQLLFEHDTVDDLAEDPPTAQPTDPQQPQQEQAGQPGQQQQQQQQPASSSS
THTASAASRPTTTATTTSSSSAVDGDSTPVPGSATASRTASDVAPSTAEGGDEEEEDEDE
REEMDSGSSAAHRGDMDADGSASSTPVGAADASARVDMSMNSTFDADSNADVLSAPAGDS
GSDIPAVPTTAAAAAAAAAKGPQYSKGHMLGIRLLTFTLDLQHRVVEECVAREVAPDQVL
EVCRSLPVAVLGELLVTLASAAKQRDALASCFVSEGLNNACRLLTALNQLLDAMPFTPEA
VQAQFAFETKTMSSDTEAQALPSHTVLDLSQQLAFSISSCLVADCASEAMRLDVVGPSVE
DGVLENAAFSAGLARPSVLEHAHWQRVLDSQLSPRDASPQRRPSTAPTSMTTTPTSSPAT
TRAAAAGKKTRGGEEDTARPGDAGATAAHMEVIEEQDGEANQQRVGDATTQPGQVEAQQE
GEQDRAHAEGSTSTNTGATKPSSSASSRVASKSTLSVDVQHGKGKSVSAGATTRPSPVPG
TTSTTTATTTASATTATGAAPSATTSSPTAVDASGDGGEGEGDADASTSLIDVMYSYAQE
NNLGLSLPRTHLVWRVTAASLVVLARHLGLTPYLQSVQTIRDVDANPLLAEVVKVAVLMQ
PHVMRLKQELRMSDADLRARTHHICMFLLTHVQPTSSGVTSASASAAEAPEADSRWHQSR
ARVSVTAAPPLDPQALSTRVNLDSSEPFDELDEQGRQAVEDLQSGLEGHDRETLAQNAPS
HPWFMLNAPQQTSLRAIPKELAELIVSFLRQPFALREVREQLVARSALAQSRIKVLRRLC
NLIELPITMPVRYQLLCGLLDPRANPYPFMPLGRYMDGISCAAAAEKRELTEYHTRVMGH
ILELLQVSCSHLLRDLNETGEASTLPLRMLHLCQNLLIQPHEPPALEQILTSDAFHALAD
VCFRVPSMVETQLHASQRARSAATAAAPTASSSSSSSSAARPSTGAPSSSASTALGGGAG
SGDDSVAEGLALFDGIESIKVSTNSGMAGALQDPSPSTLWESNGRRGAHWVLIRTRPGTV
VHRLSITPASSDSFAPRQVVVSAGTDPANLTEVRRINCSQALDPNEDIVILDRARQHYPY
IRLDVSSWGINVRLRRVSVQSLDLASLRAHIAGKPGNRRVGRRLFKYLALSASTCVDKLS
DTALAELVEQCRVALLQGADDHKASMLAVFRRMACSTRLQVLFCATPWLDMLLDLFRDAT
TTARIFVLRFMAAALPGLASESSKSTDVRMLIEQLMRAVSDFTDMTGTPENEAVLVELID
MLRSLHSLPGWRDSLNEVIVQDLFSLPHQRERLQEGTYIREEVRGVLGTLTMVGLEAPRF
RIGATCEHTLRGTGTITELNESTLKVEFHAVDDTDGPLVLSLADAEKELSVEVLRPFDFM
VACNTGHDRMAFRTLLFEAFSSWPDHILSQKMQLEMLQACKLFFRTPVAFDLFLEEQQSA
TPKAPSSRSSSVSTAVGPLGSPATTRAGDVDKARSRPARRKKRRKHRRDGSARRTRTHSG
RRSRSRNASDRSPRSVDVGLPIEVEVGATDSTPPPTASAADEAAGRGNSSGSSSASSVGA
PDSATTTTTTTTNTNTTTATATGTTTAAGTGTAAATATSATSARRRDEDDDGDDDGPNGA
ENGSLSQTESDDSGSDTDSRTSSASDSSDASESEGEGEGEEQVVDEAVAEQHGVKRSTSA
SQEDRRSVDTKFIETLLNWSVVPSPVRAEYDLPSVASVCSEVIQSFLANAPLRKPEIDMS
ACVEDGYDDVTASSNPAHIKDLLEKTHNTYWQSCTRQDEPWVRVFMKPNQFISVLRIYHD
PQDASYMPKEVQVSVGPSAGELTPLPPVQIPHDSTSTVLLEGADRYHRVVQITIKQTHNG
GVDTRIRRLEVLSGPTRHAQKKTSLEDLLAPTPEVALASGGKSADSEEHEGGEGGGAAGG
SGRRRIRHARHDSREVEELLETLMEHHDDAAGAGDGDRGEPASSSSPTEHGLRHHHRHGA
SHTSGNDAESHHHHHHHHHRHRQQTQEGIPEAAEPDDEAGYGETGEAARLGPLAAGGNNR
DGGDGGGSSANTGGANGGGSMSSTASAATGGRYSHQRPSDLVAGMFEPFQRRRGDASGTG
SGVAASVSTAAGTGADAATAARGSVGGAGGERHHDDDDDNDDDNDNVSITSETGSVSSAR
ASASQLPLPVAFVWGANAGGQMDSLFSGAQDMSQVPKPKLCTLLPRGLQVAKMCIQKEGV
VVLGHNGALYASAHSGPLKRLLPHGPKVVDVAYGGYHTLVVTEDHRLLVCGTGKNGKLGL
RDTRDQSSLVPVPGLRDVLRVACGRRHSAAVTATGQLYMWGCNHHGRLGLGDQNDRYEPT
LVPNLPPVQMVACGDRHTLVLTQRGGVYSFGCGDQGRLGIPEAPHKLLRPAKLDFGRARM
TRVICGCNSSAALTDTGQLYVWGTGRSYRLGTGSMTSHMLPIRVTDLASHKIVDASLGHE
HGVAVSETGDVFVWGSNDSSQLGGATADAAAPRPLLHPELRGKGLNRVSCGSRAVAVWRD
AANAVPEEERSDQPFTEPMPVPEDRLGRMCIEERDDSSVERIVEQVGTSPPLMALVAHLP
DPEAQQKSVAYFLKAMRVYQARQLVTLWLSRGVHALEGVPWGPDRLLLVLIDLMRVLSVR
AAADEPCRVISAAIHTLCGKHSHLSRVLVEICVMETKRAMPSSNLAEDGMVTDEMLLTRV
CSLGLIRATIDCTISYSSNLSMLRLSHALASLWISNPANRVRQWVLARLNTLLHNGSRDF
LSELRRLVHFREQESGHQQEEAAAATTTATAALATEGAGARDTGVLELLGSSASTGVAAS
SSGGNGGGRDGARRAREQRHHHMQLEAQHQHQQQRRGQRMERGGLRGDEQPQEEEQQQQQ
QQQQQHGHLRQRRHPQQELRPHGGDDTVDEGALGREAIEPLVARGSGGGDRDGGVGDEED
SLSATETSTISRMGASVDASAADDDEEDEDLDTVTSARSSNGRNSISTSPHAADDTFDDS
ELELQTSSHSGFDDNRSNDGRAHGVGSHHVGRSSGGTAGDGGGSGPHRHHQHHHHHHHRH
SHHRHSHHRHSHGHGRHSQEHHGHHHSQHHHARRRGSGGHGMSGSSSSATGVPSRRSAGG
GHTGRVLSLSEFASFNVSGSGHLNVCELSLLLLHRDVSNCYFQLAHTFAQVGLTFSHRFD
YEATHRFLLQTRLHKTAHKPLFGSGDDEDELQSSVGSVLREFSHSLWATLEMQHQHETTL
EKDGRILMRSDFNRVMCRVAAGLDLPPGSAVSSAEKPSWFRVYCTTSREFNRLVDRRPFT
EEFAQRIKAALEGRGDEEEPPEVRESLGYLDNGVYTAQMDKSILHWKAEAPQELRLAYSK
DAAPTVNMPRLTFQPLNEGHVKTSNKNTTVMMQSEASEENTWVMADEVLTSGMHYWTVRC
DSKGSARRYVGVGVGKPNAAYPLGAARILSEGLLKSGTSAIKIPRGFSPNDIIGVFLDLN
RNMVAFDVNGHKRGEIELPGLAPGEGVRPLVYLFYPGDRISFVYGLPLPACYRMGNDTRS
LFAVAGRRAIVLRAAPSVDSSRLGVLPPASSHHRHPVVVMAVDYRSNREGVWLRLANPDN
KWGEGQCWCLLRDPSGAQNLNAVDKDMDPRLVINYTEEAPPDTQLGAAGTAAGKKVAQCI
TTASRHNVRAGPSLDAMVIGGIAPSMMVYYTSKVSEGGGVWLLLDAESKERVVEPNMRHL
DAYVLFKGSDEVAYFKLEEPPPVITEPPPAYPALHGIPVGQIKRRCFLLETLSSSVLSLA
SLIEFQSMETSGGVSLGLGGTQKSLQALQDLLLLTHKERLIKAVISRTMASSTVRVTITL
NRVQIHRQPSGVAGIYGQNSVFAQACRELRNADPSVFLAPNRCWKVKFAGEGVDDAGGGY
SESISEMCEELVNGSLTLLIPTPNKVQDSGDSRDVYLFNPAANSPAELELFEFLGVLIGI
AIRTNNPISLPLAGPVWKQLTGVALTIADLREVDTDYVTTLEIIKSLSEEAFSSYGIGGD
TPSAKEGLTYQVLDVPRLTSATRDEYVRKALHLRLHEFDAQVRAVRRGVARVVPLPLLSL
LQPNELQEFVLGKQEFDLSLLQVMTRYKGLRSNSALAGWFWDAIKALTPVELSLFLRFVS
GRTRLPRTQADFEGKHFVLQALDRYEAGSSHADSALPEAITCFFTLKIPRYSSYEVLLKK
LRYAINNCKAIDTDNYARTTLPPGS
Download sequence
Identical sequences F2U2X8
XP_004996155.1.12839 PTSG_02656T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]