SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02663T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02663T0
Domain Number 1 Region: 51-96
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000135
Family TNF receptor-like 0.0043
Further Details:      
 
Domain Number 2 Region: 479-519
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000235
Family TNF receptor-like 0.0067
Further Details:      
 
Domain Number 3 Region: 355-396
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000235
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number 4 Region: 690-728
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000265
Family TNF receptor-like 0.0035
Further Details:      
 
Domain Number 5 Region: 560-599
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000188
Family TNF receptor-like 0.0053
Further Details:      
 
Weak hits

Sequence:  PTSG_02663T0
Domain Number - Region: 99-135
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000137
Family TNF receptor-like 0.008
Further Details:      
 
Domain Number - Region: 439-476
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000225
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number - Region: 520-557
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00104
Family TNF receptor-like 0.0068
Further Details:      
 
Domain Number - Region: 3-43
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0171
Family TNF receptor-like 0.016
Further Details:      
 
Domain Number - Region: 768-805
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0194
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number - Region: 604-643
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0306
Family TNF receptor-like 0.0064
Further Details:      
 
Domain Number - Region: 810-866
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0706
Family TNF receptor-like 0.015
Further Details:      
 
Domain Number - Region: 146-193
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0785
Family TNF receptor-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02663T0
Sequence length 1331
Comment | PTSG_02663 | Salpingoeca rosetta conserved hypothetical protein (1332 aa)
Sequence
MDTCAPCPAGWTDHDANSTTACVQCAPGSYDDDLDASTLCVACDVGNTFQDETAQTTCKP
VSPCEPGTFVVLNATVDRDTTCKRCPPRTFTAAANAGTCRPWSTCGAGQQPLVSPTPTSD
RVCVPCPTETYKPFAGDFACFNATAPCQLSEEVQPPTATSDRVCRPCGADTFFSGQMGTC
VSLRACNSSIEYASSPPTMTTDRACSSLRVCTRDEYMSVPPTSTTNRQCTPLTVCSPSEY
EERMPQMGADGDAFVSDRTCTPCTVCPLGATQPCTATSDAVCRGCGNVTCDAGVSFETAP
CTASTERVCSACGTCGPRAFASSPCTPTANVTCAPLDTCADGSEFEAVPPTATSNRVCRA
LSSCRSGHFVAVNATKTSDRVCAPCQDGTFSQDTNTDACQAWTVYDAGTVQVVAPTSSSD
RLCSPCGHNTFRSADMPACTPFTTCVAGEHVQQQPTASSDRVCSTCNDGTFSIHENAPAC
TPYTSCPPGTRVSVIGSPSGDQTCAPCPANTFSNVSNAFSCTAHRVCQPGTHRVGGTATT
DVACVACVDGTYSVSVNADTCAPHSTCGAGTHVSVSPSATSDRICAACAVGTWSDDPNSD
AGACEAVSDCLPGSMVVQSPTLSTDRVCSACVAGVSYQPEANARECLTVRAPCAAGSYES
APATVTSDRECTRCDVSLNAYQPRAGSRFCLVSSGCGRGEYVQQALTPTSDVVCQPCPPG
THLPSSSSSSSSSSSSSSGGGAVQSCMPCVDGTYQPYSGQTQCFDAAQCPIGHVEVSPPT
TTTNRVCELCDGVSFYHDPAQSQQCQEVSTCGELEVEVAPATAVSDRVCQCNTLKAYTDI
GTGACVQLSECRGDDVEVQAPTPTSDRTCVQATAVVSVQFVFKALEFALVRSGGTTAFMD
EMAGIIKSRISAISGRDSGERVRAYVVRLREGSTIVEAALVYDAGTTSGADTAVMQDVLF
RVRDAIEEDISAGQIAITWPLVDGGVSYVANFTSERRPCGVDQFSATGYAPCSSCPPGHV
HSASRMECIDCYLNATTRGCDQIMVPKASSSSDSGASIPVVGVVFICIALGCIAGAGIMY
LVRGKAKVRVIVVPEATDDGTPRKAETGATTSFANPLFGSNSSSSSSRAHQERPGSARSA
WLEGDYESGGVEYRNAAFGRGDTRGGGGDDGGYQPLPRTGPGYDRPMRREEEDPYASVDP
HVPGSISDAKSQYYELRDSRLGASTTSHTDTWDIDVRDIRTPPQRPSRPSWSDDALKVES
LTPRPPPRVPRSLPPLCHPNTNDRQQQQQLRQGRWRRNDAAAASTAVSSDAAMSADTTSG
NATAHQPSSDA
Download sequence
Identical sequences PTSG_02663T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]