SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02758T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02758T0
Domain Number 1 Region: 2129-2199
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000158
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 2 Region: 883-958
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000988
Family Calmodulin-like 0.047
Further Details:      
 
Domain Number 3 Region: 1460-1558
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000193
Family Tropomyosin 0.0031
Further Details:      
 
Weak hits

Sequence:  PTSG_02758T0
Domain Number - Region: 1072-1349
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.00068
Further Details:      
 
Domain Number - Region: 2880-2973
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_02758T0
Sequence length 3803
Comment | PTSG_02758 | Salpingoeca rosetta predicted protein (3804 aa)
Sequence
MDPYGGGDSPDSDDRQMSIAAGQRVLARRRRSRQRAAREQQQQQQTQQQTQHSRDDAGTS
TFTGQSLASLLSHEPDSSYGEQGGQQYSSDDDQRTVVPSTEHSPNRSWGDAVDVQLSRSD
DDDSSRSTDTQQQQQQQQRFQHLHQPQHQEQVQYEQHQGRQHRSGSPLQQHVLSPSPVAS
PERGPSQHAAGAHDDFDPEMWNIQRQASLRRRINKSENIYKGADKLSKEVAKDTRKDLQY
TMKYMREDIRRTEKELEDVERIEYASFDELQRRLSTELRKLEGARNLRQVLMVQHPERTA
ELAEVEKQIRNAQSAIRAIEASMQGDDESWEDEDEEKEHADTFDVHDVPNYQDANGGSHA
QTAAAAATSTSPLPGDVSGASASAHSLLGESHNSSTSAFASSNASHWSESGTNPALGAWV
DRDEEALGDLRARIQRALALTEAESAHEEIQGLGALASKLLQEREDLKQQLARLQHGAQA
EKKRAEDAANDENNELLRMVEDMQAEQDTLQQQLDSYKAETVMLVDHLKSDPDGTLVLTH
RELHAVYRCTVDARTERAQLQRALETLRKDVSSLEQDVLDRNGQVARLSDALSAARNNLH
MTQTDKTQLEHVLATTKEELLTVQESRAAAGDALSSLQADMDDMRARLAEEQQRTRALQE
ELDAARAGASDSAAAQAVAWEDERRALQQERDKHAEHARRVQKELAAMEQEVLAQATSVQ
RSQEEMRDHVTKLETELSALRQRHTELQAQYEDAQASLANAQQQQQQQQQQHEQHQQQQA
DNSVNNNDSMRGGSELDATWQEQKTELEQQLRAIQQEADRYKHASEEAEATLAVTRKELE
SARHHAAHMRTRDRTSSAHSSSTQHTAELSLPEPLATNHRNWVLGMQHMMSQDKLRAKDL
FDRLDSHGRGYLQLRDFERSLKWIDLSMSDRELRDLFNHIDHNKDSRIDSDEFKRDIKYK
YNKSRHDYHGPEGHALGAVRITPSQSEDSDAFSIDLDQLSTVDQYHTALQRALSRLQQLE
RQQRHALDSEDGSSHARSASPSTTGGGSGTGDGSNVQRLERENHAQRSEINSLKQQLRDL
QLQLDEEAARNLNMSADMRQFDESINASFRSPAELRMENARLAQELEEAKAAVEQLSTAR
QRLEVQHKAYKQQIGDLEQDVKLYGDDAKRRDAHEAQMEADIEELREQIAQLESEKTAVG
RTLAQAEARLAAQAEEQRMTAADAQRTLEQTQRRLQEAEAEKDTLQARVREEEERAARLK
QQLADMTDQFQAASTRAEETVQSQMQRDQEVTQLREQLAKAKNEAQVAQTRLNAEQQRAT
ALQAENDGFVRQLKEKQREIEQQQADMRTMYDEHTKVLARCEVLTSQADGLELDKVAQSE
DMDKLKARVEALAQEAEDKKREAQRHQEELKRVIQAKNETATERDLVRKQHEDLSRRLAD
LQAQYDGLQADHDAALATCDELKRKLTAAEDQAAKAREQVRGAEERAASLDEKCTQLRSA
EHATHDKLSRVVEERQQLRDDLEQAVQRAERAERDAQDLRNDVRAARQERDDLLKALDEA
KSSSSEAQQKVQEAERAARDALAARVQELEQQKDEEHKRWQREVSELQSTLAEQRGEARQ
LQASLRQAEDRLSASIEERERLKHELQEAESRAEGAAAATRTAEQDLREQVARAEERCKQ
LEEEQQALRDKCKKAESAVAKRDALHSNKEAMYAKQMEGFQFETQQWRARAETYSSQLDE
LRAQLAQRQQEYDTLAQEKRAAATAAASDATGSTGTVQQQEYDDAMNTLKDTMKELEKAK
VEVARLEEAVALRQRAIEERDGRLEDVERELVHLRSEVATLDADLSLKNSYIEDLEAAVK
DRRGYASSTGRQSATSLVSSVPGVVSPSSRADSSPSQHTEHSPPAFAHERAGRSGVGGGD
GVGGGDGVGGGGASSTDDEVGGAQVTAAGEGQRKRGPRRPRPGYPSSTAMTPSTTTEAYR
DPRYVPAEEARVAQEERDQYEHRIAGLKEQVVKLREALQAARAEVDTVTRNHDLHIQHSE
ARVKALNDELATQQAEYTRELELEKKNHRQDVDALEAKLKSQVERHEEACKGLKYRISAD
GKELSTLKRRLDESQNSLNELIQQELRTVQHLRAFVACHDYRPMEVHDGCDRSTELPFDQ
GDLVYVVGSADTDGYFEAIVPGRRGLVPSNYVEELQLSRDELVRSAQSNKPLWNFVIREE
DESSDKATTLAQPPNARAYEGGGHGGGDDEAVAAGRQEEEAREQQRQLRAARIELETLRA
EQKRLMHDKEDLLNRMEVLDLENGRLQGDVSALSAQLTARAHSDADSGVNNESTEARAAV
VRLEERLANEEELSRQYGKQLRLKQQELERHQQRVSELEQQQLAAGHAGEEQRGALQKMA
VAIQDLEKQVAKHRAEAEDATERAAHANDALRRVRREMKEQLEKKDGELKAQQEVLDMLS
KSYSDNMTRDTPTHDGGSDGRGGRQHKSQQRRIRELEDMLHASRARNDHLERMLDSAHAE
QQRMTAEMLDLESRYIVESMDHGKQEDKADAGRAGRGDDGADGADDEGAVRGKGAGNLFD
DLRQEQAGGAQAMNKGEQDEEDEEDEVVKARHEYSVQGRVSDDKYRLQQGLRRQRERGEG
SLRGVPMRALSPTSSLFVERRALSQVSTERSVSPSEALRAELEAEAAEEEQQQKQQQQQQ
QQEARGTTRSTSAASSERDPQTREFLAEIRKLQEVLHEKEQHVSYLEHELAALQKKVASG
EGESSSSDDAGAGAGADEAVAVKVRSLQSTLQQLTAENTELQDQRNRARSLIVSLSTAMH
DTAARVQHLHTSRHVEAVDDEALATDVQAVVRSMERLEAAYTQGIEFANGQRDELVIRLQ
ELHQRALQLEEDLERAEDRAAAAAKARQASQDDVTLARRASVQLERERDAAAASVREAEA
RAVDLEAELKAVRAQLEDTRATLQARIDELTSSAAAASAQHAHELQEAQQKLAEAEEQLR
TEQNRTREQQEGTAKEISDLKQRLDDELEQKAQLQAKLTEHITLVRATLESQQTSSHRWN
DEEEEDEEDEDVIGGEGGGRRARGATGDEDEDKMEEDEEHVRRLTAERARRRERVSALAA
RLQVEDAALHILDESQDDRILEEFDKLMELVNRELADTRKLKLELKAYRRRVQSEETSLA
QENKDLHTQVMTLEGRLRSVLEDMRHQTREHDDTMHRLQAQLENANTKIRRLDGALADMH
AEVSRIHLASSQQGQSSMPGSPLRSSTTDRAGQVLRDLRALQSTYARVESENRELQSEVR
RLRQHMQQTHTVVKDAHALRSEVREHLRTPLKHARQLDELMRAEADLASDVDCRSHKTPE
LDRFMRASMRESVVGGAGEKAPEDVLVFLREELTSYQKIFEELSSTTSLQARIIDQLMAD
KRELARDRAATTREPLRDVSNSGEMHSSDQRPGDGTLRASDLTQQHQHAQRSSTGRELLR
ETHHHYYYDAGTRTMPERGRGPTAVHSRQQEADAALIKDVQRLHDQLTSKEKELARVQRD
LLQHMGLVSEQTTVIEQLESVLKSREHDLKRAKEHNNRAQLEAKTLRHAVVELETRITSA
EEAYKVSQDHCVVADRRARDLEARLMEKERELREMLTQTIRREHGGGSVHSPSSSSPLSS
KTTTTAATTAATSHELRVQTEKANKYRLKYIRAESFRKALVYQKRYLILLLGGFQESESA
TLRAIAQLGDLSESTLSPLRRQQQDEHGHHRHRRHHHHHRGEEEEESGLRRFKRAALTVR
AAVRLRLLRKQWQGAREKLSRVP
Download sequence
Identical sequences F2U383
PTSG_02758T0 XP_004996260.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]