SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02815T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02815T0
Domain Number 1 Region: 63-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.81e-53
Family Putative alpha-L-fucosidase, catalytic domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02815T0
Sequence length 463
Comment | PTSG_02815 | Salpingoeca rosetta conserved hypothetical protein (464 aa)
Sequence
MTCRAGRAVVHRFICARHNKAEEAVAAFPLGAYGHLGPACVHMTVHRTNASGVCQPRHAA
TPCPTNSVPLPTLAQQRYQRHEIVGLTHFNMATFVHNGDPACSSTNWNQGVNCSNPAVFN
PVKLDIDNWIASYKALGAKHAVLTAKHGCGFLLWSTNTSLPNGRPYGYGVQRPNVPSFPR
DVVLEFSTKMQAAGLGHGFYYSTGNNFYLNRIDFKPAGALLPGQVNVTDKEYNTLVFEHV
RELWSRYGNLTEIWFDHGYAGDQKAALQQLLQQYQPHAAGFNGYGIMPSPVKWCGTESGT
PPRGFWSTGCDASSGNPNATSYCPTGVDTTLQDFDTWFWMPGVPIRSLGAMMDVYHASVG
NNGVLELDFAINRDGLVDATHAVLYKQLGDWIRACYGTPLANASATGTTVTLTFQQPVTT
DRFMLQEAFESGERVRTWRIDVQEKNHLQQMRQRHEGEYAPRR
Download sequence
Identical sequences PTSG_02815T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]