SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02843T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_02843T0
Domain Number - Region: 112-209
Classification Level Classification E-value
Superfamily NHL repeat 0.000288
Family NHL repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02843T0
Sequence length 220
Comment | PTSG_02843 | Salpingoeca rosetta predicted protein (221 aa)
Sequence
MPFISSVAGEVTLVEDDVGAFHINTSDPASQPVFVNGMNVDALFETVAAQQSMLQVYQQN
VQTQQSMIAIQQDTITAQQGRIDALRAEACSASSFTFDDFGTLVFKWAGGVLANNGLIYA
APFSSESVLIIDPSTNTADTTTISELGIDSDKWSDAVLAHTGLVYMFPSHRETMLIVDPD
TNTADTTTIQSLGVGTGKWFSGVVADNGRIFGVPPLLCYP
Download sequence
Identical sequences PTSG_02843T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]