SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02972T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02972T0
Domain Number 1 Region: 504-713
Classification Level Classification E-value
Superfamily Smc hinge domain 2.35e-44
Family Smc hinge domain 0.00076
Further Details:      
 
Domain Number 2 Region: 1058-1262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-35
Family ABC transporter ATPase domain-like 0.0000576
Further Details:      
 
Domain Number 3 Region: 19-242,1174-1254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.53e-35
Family ABC transporter ATPase domain-like 0.00045
Further Details:      
 
Weak hits

Sequence:  PTSG_02972T0
Domain Number - Region: 706-795
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00111
Family PspA lactotransferrin-binding region 0.0048
Further Details:      
 
Domain Number - Region: 789-894
Classification Level Classification E-value
Superfamily Tropomyosin 0.00213
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02972T0
Sequence length 1324
Comment | PTSG_02972 | Salpingoeca rosetta Smc4l1 protein (1325 aa)
Sequence
MSEGASGGSGADGRTPRLMITKMRLENFKSYYGVQECFSAVVGPNGSGKSNVIDAMLFVF
GFRAKKIRQAKLKDLIHNSEHHQNLPSCRVSVFMQEILDRDDGGFDIVPDSELVVAREAT
SSSQSFYYLNGKKRTFGEIADVLRSKGIDLDHNRFLILQGEVEQIAMMKPKAQNEHDVGL
LEYLEDIIGSVRFKEDIAKHELMLEELNEKRNEKLSRVHVVEEEKNALEAGKKEAEAYLM
QENELTMLRSKLFQCHLHQATENLEQLQEQADAKRRAVKDAKQEMKTVLHESKGIQKQYE
KDKREYDSLKKAAEKAKADFIAYERKDIKHKEDMKHNKTKLKRIEKSMQKDEKALNEATS
QVTAAQDDVSRLTDEIKGLEVSLSKEEKVLESLYNEFEDDRLAVQQRLHEKQEALVPLSS
ARDNAAAAYDIKKSERDLLTKGARDIEAQLQEATEGLAHARATLKERKGELVTLAARKKK
LEAEVPAAEKQLRVLAKNQGPLDDEVSTRRMKLEERRSASQAQHTTNRVLEALKERARRG
KITGFHGRLGSLGAIDDKYDCAVTTACGALNHLVVDTVEQGQQCVEFLRKHNVGRATFII
LEKIQHLAAQADKPFNAPAPRLYDLIRVKDDKFKVAFYHALRDTLVAPSLDDATSIAYQG
KRARYRVVTLKGQLIDTSGTMSGGGNKVQRGGMSSTLAEEVSPAELESLERELEQLVQRQ
RKAREQRSTWEEAVGAAKRELATVTANAQRCQQEIDSLTAKIDALTEKIATLEEQAKTVE
NNEAALAAVEKELAALGKKRDSAAAKAEKVEHEIAALEEELANVGGVRVKAQRAKVDGIS
DEISTLQGNITKANVTAKTAKRKKTQLEKKLEKAQAEKEETAAAIAKLKESFADIETKAL
EVMEEQKKATLLLEEREEAMQDIKEKYDQVEERLQALRSGLVDQEHELEEVDRELRDNQN
KAKHWRRKLDALTLHKIDVDVDEEQEEEQEEAASADGTGGKSAMNTGDDDDEEEEEDKPS
GDADNGDDENDEGGEEQPRRKKSKRTTQQQLPTLTAEDAAALNVDDLEYNITVLDEKLKG
MKPNMSAISEYRKKESEYLARVDELDTVTGERNAVRAQYDSLRKQRLDMFMAGFKTISLK
LKEMYQMITLGGDAELELVDYLNPFSEGIVFSVRPPKKSWKNISNLSGGEKTLSSLALVF
ALHHFKPTPLYVMDEIDAALDFKNVSIVANYIKERTKNAQFVIISLRNNMFELAVCFVGI
YKPEMAPRASPSTRHKSQVPRRCVFLREKARAHAAQAVTAAREPKRAANESMPLAEVDAA
ATTH
Download sequence
Identical sequences PTSG_02972T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]